Genomics and proteomics search results

BMP7 Recombinant Human Protein (Gibco™)

Recombinant Human BMP7 is a bioactive protein intended for use in cell culture applications. BMP7 is a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta (TGF-β) superfamily. The TGF-β superfamily includes many families of growth ...

Specifications

Purity
95 %
Species
Human
Activity
50 ng/ml
Bioassay
Induction of alkaline phosphatase in ATDC5 cells
Expression
Mammalian
Gene Aliases
BMP-7
Protein Form
Recombinant
Ligand
Purification
Gel-Purified
Protein Family
Growth Factors & Receptors
Endotoxin Level
< 0.5 EU/µg
Protein Subtype
BMPs (Bone Morphogenetic Proteins) & Related Factors
Molecular Weight
38 kDa
Research Category
Bone Research
Stem Cell Research
Differentiation
Validated Application
Cell Culture
Purity or Quality Grade
Carrier-Free
Protein Length or Portion (a.a.)
139 aa
Shipping Condition
Dry Ice
Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.

Related Applications

PHC9543
077bd85ba21f7cc657819a59e6878812_CmgtBuyProduct

BMP7 Recombinant Human Protein, Active (Gibco™)

Recombinant human BMP7 is a bioactive protein intended for use in cell culture applications. BMP7 is a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differen ...

Specifications

Form
Lyophilized
Purity
98 %
Species
Human
Expression
Mammalian
Gene Aliases
BMP-7
Protein Form
Recombinant
Ligand
Purification
Sequential Chromatography
Protein Family
Growth Factors & Receptors
Endotoxin Level
< 0.1 ng/µg
Protein Subtype
BMPs (Bone Morphogenetic Proteins) & Related Factors
Molecular Weight
28.8 kDa
Research Category
Bone Research
Differentiation
Stem Cell Research
Validated Application
Cell Culture
Purity or Quality Grade
Carrier-Free
Protein Length or Portion (a.a.)
232 aa each (homodimer)
Shipping Condition
Wet Ice
Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.

Related Applications

PHC7204
69db284f647b608dd9aea00ec365a6ec_CmgtBuyProduct

BMP-7 ELISA Kit, Mouse (Thermo Scientific™)

The Mouse BMP-7 ELISA research-use-only kit is an enzyme-linked immunosorbent assay designed for the quantitation and detection of BMP-7 in samples (see sample types indicated) using a microplate reader. The assay will recognize both natural and recombinant forms of this target. ...

Specifications

Gene ID
12162
Species
Mouse
Gene Symbol
BMP7
Gene Aliases
RP23-188A4.1
OP1
Protein Family
Cytokines & Receptors
Accession Number
NP_031583.2
Detection Method
Colorimetric
Research Category
Development
Shipping Condition
Approved for shipment on Wet or Dry Ice
Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.

Related Applications

EMBMP7
b09d3094302611fb93f2d5b972620456_CmgtBuyProduct

BMP-7 ELISA Kit, Human (Thermo Scientific™)

The Human BMP-7 ELISA research-use-only kit is an enzyme-linked immunosorbent assay designed for the quantitation and detection of BMP-7 in samples (see sample types indicated) using a microplate reader. The assay will recognize both natural and recombinant forms of this target. ...

Specifications

Gene ID
655
Species
Human
Gene Symbol
BMP7
Gene Aliases
RP11-560A15.5
OP-1
Protein Family
Kinases & Inhibitors
Accession Number
NP_001710.1
Detection Method
Colorimetric
Research Category
Angiogenesis
Shipping Condition
Approved for shipment on Wet or Dry Ice
Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.

Related Applications

EHBMP7
4a88c74844640bd8e45d9ad60155416e_CmgtBuyProduct

Pierce™ BMP7 Antibody (Thermo Scientific™)

For Western Blot, this antibody has non-specific bands at 10 kDa,33 kDa and 38 kDa. ...

Specifications

Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.
PA534602
b9a907f111a5ba2696a62cb66aa6c1aa_CmgtBuyProduct

Pierce™ Bmp7 Antibody (Thermo Scientific™)

This antibody is predicted to react with mouse based on sequence homology. ...

Specifications

Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.
PA511720
4babda6c5c73b55c9107b2b4adf7dec0_CmgtBuyProduct

Pierce™ CRIM2 Antibody (Thermo Scientific™)

A suggested positive control is Jurkat cell lysate. ...

Specifications

Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.
PA534411
b299cf6c7939f1a9f885f4357bdfeffd_CmgtBuyProduct

Pierce™ CRIM1 Antibody (Thermo Scientific™)

A suggested positive control is Jurkat cell lysate. ...

Specifications

Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.
PA534410
2d044d830890c9ed383115c75e5d886a_CmgtBuyProduct

BMP7 Antibody

Peptide sequence: QGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQ ...

Specifications

PA540524
4d4290ad5c6011cead8f7174d283b706_CmgtBuyProduct

BMP7 Antibody (164313)

In ELISAs, this antibody shows approximately 25-50% cross-reactivity with recombinant human (rh) BMP-6 and no cross-reactivity with rhBMP-2, -3, -4, -5, or -8. ...

Specifications

MA523878
b881e21d24da2f86904d363b9bdc1bf4_CmgtBuyProduct

BMP7 Antibody (164311)

In direct ELISAs, approximately 25% cross-reactivity with recombinant human (rh) BMP-6 is observed and no cross-reactivity with rhBMP-2, -3, -4, -5, or -8 is observed. ...

Specifications

MA523877
03ea3254993fa510d15cf9a3eceb5d95_CmgtBuyProduct

Pierce™ BMP6 Antibody (Thermo Scientific™)

PA5-28378 targets BMP6 in WB applications and shows reactivity with Human samples. ...

Specifications

Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.
PA528378
0e7dc74a268a8edc5f200ba39347de09_CmgtBuyProduct

Pierce™ Bmp6 Antibody (Thermo Scientific™)

The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to in ...

Specifications

Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.
PA511719
7bde545adc07f90bf7825c5b291f1356_CmgtBuyProduct

Pierce™ BMP-8 Antibody (Thermo Scientific™)

PA1-31216 detects BMP8 from rat, mouse, human samples. ...

Specifications

Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.
9a92467ba24b84cf6336dd04392063de_CmgtBuyProduct

BMP6 Antibody (74219)

In Western blots, no cross-reactivity with recombinant human (rh) BMP-2, rhBMP-4, rhBMP-5, or rhBMP-7 is observed. ...

Specifications

MA523844
ae445ca14383e1b57347c8104acad446_CmgtBuyProduct