Genomics and proteomics search results

Pierce™ pan Ras Antibody (Ras10) (Thermo Scientific™)

MA1-012 has been successfully used in immunoprecipitation, immunohistochemistry, flow cytometry, immunofluorescence and Western Blot applications on human, mouse and monkey samples. ...

Specifications

Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.
ca0f25964e95f261cf515f94ac1c5b0d_CmgtBuyProduct

Pierce™ pan Ras Antibody (Ras10) (Thermo Scientific™)

MA1-012X has been successfully used in immunoprecipitation, immunohistochemistry, flow cytometry, immunofluorescence and Western Blot applications on human, mouse and monkey samples. ...

Specifications

Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.
d5d554a1a9674e878f2c1694784d81a4_CmgtBuyProduct

Pierce™ N-RAS Synthetic Peptide (Thermo Scientific™)

PEP-1603 can be used as a blocking peptide with polyclonal antibody PA5-34560. For use as a blocking peptide in Western blot, incubate the peptide with equal volume of antibody for 30 min at 37ºC. ...

Specifications

Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.
PEP1603
f9356fd06903b23a63e08100de77e780_CmgtBuyProduct

Pierce™ N-RAS Antibody (Thermo Scientific™)

A suggested positive control is 293 cell lysate. ...

Specifications

Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.
PA534560
22b54de4222b716d7cb52e8b0c0cadf4_CmgtBuyProduct

Pierce™ CSDE1 antibody (Thermo Scientific™)

PA5-22394 targets CSDE1 in ICC, IF, IHC (P), and WB applications and shows reactivity with Human samples. ...

Specifications

Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.
PA522394
b6d406ced4c57d346f6d43ffcd2bd494_CmgtBuyProduct

Pierce™ N-Ras Antibody (Thermo Scientific™)

This antibody is predicted to react with canine and mouse based on sequence homology. ...

Specifications

Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.
PA518888
12d696481498cab9d1977b9b4c37dcfd_CmgtBuyProduct

Pierce™ N-Ras Antibody (Thermo Scientific™)

PA5-28861 targets N-Ras in WB applications and shows reactivity with mouse samples. ...

Specifications

Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.
PA528861
374f6b981c966c0277c69733577aaa92_CmgtBuyProduct

Pierce™ N-Ras Antibody (Thermo Scientific™)

This antibody is predicted to react with porcine based on sequence homology. ...

Specifications

Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.
PA514833
29422e67dcec03c7d9da74bb25d40c48_CmgtBuyProduct

Pierce™ RASGEF1A Antibody (Thermo Scientific™)

PA5-31598 targets RASGEF1A in WB applications and shows reactivity with Human samples. ...

Specifications

Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.
PA531598
6e97c63674137e4284e06931a712af09_CmgtBuyProduct

Pierce™ RASGEF1A Antibody (Thermo Scientific™)

PA5-31717 targets RASGEF1A in IHC (P) and WB applications and shows reactivity with Human samples. ...

Specifications

Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.
PA531717
560be147b7ecc270372c08b591e7980d_CmgtBuyProduct

Pierce™ ZDHHC9 Antibody (Thermo Scientific™)

The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS. ...

Specifications

Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.
PA526721
b470a587b81dcfbc004ce8ecaa9a57ca_CmgtBuyProduct

GOLGA7 Antibody

Peptide sequence: MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTL ...

Specifications

PA544628
f1edea9f75c943232cade3c38ab3251a_CmgtBuyProduct

Phospho-PKD1 pSer205 Antibody (Thermo Scientific™)

This antibody is predicted to react with human and rat based on sequence homology. ...

Specifications

Regulatory Statement
For Research Use Only. Not for use in diagnostic procedures.
PA540259
b40f1f59acd5a7e955769cb09249617d_CmgtBuyProduct