Product Specifications | |
---|---|
Species Reactivity |
Human, Mouse, Rat |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
E. coli-derived human ADH1A recombinant protein (Position: K213-F375). |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Antigen affinity chromatography |
Storage buffer |
PBS with 4mg trehalose |
Contains |
no preservative |
Storage conditions |
-20°C |
RRID |
AB_2745846 |
The synthetic peptide sequence is 497-536aa, EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQ
Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.
This gene encodes a member of the alcohol dehydrogenase family. The encoded protein is the alpha subunit of class I alcohol dehydrogenase, which consists of several homo- and heterodimers of alpha, beta and gamma subunits. Alcohol dehydrogenases catalyze the oxidation of alcohols to aldehydes. This gene is active in the liver in early fetal life but only weakly active in adult liver. This gene is found in a cluster with six additional alcohol dehydrogenase genes, including those encoding the beta and gamma subunits, on the long arm of chromosome 4. Mutations in this gene may contribute to variation in certain personality traits and substance dependence.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: ADH, alpha subunit; ADH-A2; Alcohol dehydrogenase 1; alcohol dehydrogenase 1 (class I), alpha polypeptide; alcohol dehydrogenase 1 temporal, liver; alcohol dehydrogenase 1, complex; alcohol dehydrogenase 1, electrophoretic; Alcohol dehydrogenase 1A; alcohol dehydrogenase 3, electrophoretic; Alcohol dehydrogenase A subunit; Alcohol dehydrogenase subunit alpha; aldehyde reductase; class I alcohol dehydrogenase
Gene Aliases: Adh; Adh-1; Adh-1-t; Adh-1e; Adh-1t; Adh-3e; ADH-AA; ADH1; Adh1-e; Adh1-t; ADH1A; Adh1c; Adh1tl; Adh3-e; AI194826
UniProt ID: (Human) P07327, (Mouse) P00329, (Rat) P06757
Entrez Gene ID: (Human) 124, (Mouse) 11522, (Rat) 24172
Molecular Function:
dehydrogenase
oxidoreductase
metabolite interconversion enzyme
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support