Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
FIGURE: 1 / 8
Annexin A4 Antibody (PA5-78781) in IHC (P)
Immunohistochemical analysis of ANXA4 in a paraffin-embedded section of human colonic adenoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution).The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/mL rabbit anti-ANXA4 antibody (Product # PA5-78781) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit I... View More
Product Details
PA5-78781
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human Annexin IV (119-152aa EEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVL).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
no preservative
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2745897
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human HepG2 whole cell, human A549 whole cell, human THP-1 whole cell, human Hacat whole cell, rat stomach tissue, rat lung tissue, mouse stomach tissue, mouse lung tissue. IHC: human breast cancer tissue, human colonic adenom tissue, human liver cancer tissue, human placenta tissue, mouse kidney tissue, rat kidney tissue. Flow: HEL cell.
Target Information
Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANX4 is almost exclusively expressed in epithelial cells.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: 35-beta calcimedin; 36 kDa zymogen granule membrane-associated protein; Annexin A4; Annexin IV; annexin IV (placental anticoagulant protein II); Annexin-4; ANXA 4; Carbohydrate-binding protein p33/p41; Chromobindin-4; Endonexin I; epididymis secretory protein Li 274; Lipocortin IV; P32.5; PAP-II; Placental anticoagulant protein II; PP4-X; proliferation-inducing gene 28; proliferation-inducing protein 28; Protein II; ZAP 36/annexin IV; ZAP36
Gene Aliases: AI265406; AIV; ANX4; ANXA4; AW106930; HEL-S-274; P32.5; PAP-II; PIG28; PP4-X; Xanx-4; ZAP36
UniProt ID: (Human) P09525, (Mouse) Q3UCL0
Entrez Gene ID: (Human) 307, (Rat) 79124, (Mouse) 11746
regulation of transcription from RNA polymerase II promoter
signal transduction
Notch signaling pathway
epithelial cell differentiation
negative regulation of NF-kappaB transcription factor activity
negative regulation of apoptotic process
negative regulation of catalytic activity
negative regulation of interleukin-8 secretion
exocytosis
kidney development
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support