Search

  • Order Status
  • Quick Order
  • Promos

Invitrogen

Aquaporin 1 Polyclonal Antibody

3 Published Figures
3 References
View all (36) Aquaporin 1 antibodies

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Certificates
Protocols
Questions & Answers
Datasheet
Certificates
Protocols
Questions & Answers
Datasheet
Certificates
Protocols
Questions & Answers
{{$ctrl.translations['antibody.pdp.skuNotes.additionalInformation']}}:

{{$ctrl.translations[$ctrl.isSkuNotesCollapsed ? 'antibody.pdp.skuNotes.viewMore' : 'antibody.pdp.skuNotes.viewLess']}}
Aquaporin 1 Polyclonal Antibody

Product Details

PA5-78806

Applications
Tested Dilution
Publications

Western Blot (WB)

0.1-0.5 µg/mL
-

Immunohistochemistry (IHC)

-
View 1 publication 1 publication

Immunohistochemistry (Paraffin) (IHC (P))

2-5 µg/mL
View 1 publication 1 publication

Flow Cytometry (Flow)

1-3 µg/1x10^6 cells
View 1 publication 1 publication
Product Specifications

Species Reactivity

Human, Mouse, Rat

Published species

Hamster, Mouse

Host/Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human Aquaporin 1 (240-269aa DRVKVWTSGQVEEYDLDADDINSRVEMKPK).
3D Epitope / Immunogen

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Lyophilized

Concentration

500 µg/mL once reconstituted

Amount

100 µg

Purification

Antigen affinity chromatography

Storage buffer

PBS with 4mg trehalose

Contains

no preservative

Storage conditions

-20°C

Shipping conditions

Ambient (domestic); Wet ice (international)

RRID

AB_2745922

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Positive Control - WB: rat heart tissue, rat kidney tissue, rat lung tissue, mouse heart tissue, mouse kidney tissue, mouse lung tissue. IHC: human kidney tissue, mouse kidney tissue, rat kidney tissue. Flow: U2OS cell.

Target Information

Aquaporin 1 is a 28kD integral membrane protein which was originally identified in red blood cells and renal proximal tubules. AQP1 is also expressed by the choroid plexus and various other tissues. It forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Bioinformatics

Protein Aliases: 28 kda erythrocyte integral membrane protein homolog; AQP 1; AQP CHIP; AQP-1; Aquaporin 1 (aquaporin channel forming integral protein 28 (CHIP)); aquaporin 1 (channel-forming integral protein, 28kDa, CO blood group); aquaporin 1 (Colton blood group); aquaporin 1, Colton blood group antigen; Aquaporin CHIP; aquaporin-CHIP; Aquaporin1; bloodgroup CO protein; channel-like integral membrane protein of 28 kDa; channel-like integral membrane protein, 28-kDa; CHIP 28; Colton blood group; Colton blood group antigen; delayed early response protein 2; DER2; growth factor-induced delayed early response protein; MGC26324; unnamed protein product; urine water channel; water channel protein for red blood cells and kidney proximal tubule

View more View less

Gene Aliases: AQP-CHIP; CHIP28; CO

View more View less

UniProt ID: (Human) P29972, (Mouse) Q02013, (Rat) P29975

View more View less

Entrez Gene ID: (Human) 358, (Mouse) 11826, (Rat) 25240

View more View less

Function(s)
intracellular cGMP activated cation channel activity potassium channel activity water transmembrane transporter activity protein binding ammonium transmembrane transporter activity potassium ion transmembrane transporter activity glycerol transmembrane transporter activity water channel activity channel activity transmembrane transporter activity nitric oxide transmembrane transporter activity carbon dioxide transmembrane transporter activity identical protein binding ephrin receptor binding hydrogen peroxide channel activity
Process(es)
glomerular filtration renal water transport potassium ion transport water transport cell volume homeostasis hyperosmotic response response to hormone cellular water homeostasis positive regulation of lamellipodium assembly positive regulation of epithelial cell migration carbon dioxide transport glycerol transport sensory perception of pain cellular homeostasis lateral ventricle development pancreatic juice secretion nitric oxide transport positive regulation of cell migration establishment or maintenance of actin cytoskeleton polarity secretion by cell cerebrospinal fluid secretion secretory granule organization cellular response to UV transepithelial water transport carbon dioxide transmembrane transport wound healing odontogenesis negative regulation of apoptotic process response to estrogen lipid digestion positive regulation of angiogenesis positive regulation of saliva secretion positive regulation of fibroblast proliferation camera-type eye morphogenesis defense response to Gram-negative bacterium multicellular organismal water homeostasis corticotropin secretion transmembrane transport renal water absorption cellular response to hydrogen peroxide cellular response to mechanical stimulus cellular response to copper ion cellular response to mercury ion cellular response to retinoic acid cellular response to cAMP cellular response to hypoxia cellular response to salt stress cellular hyperosmotic response cellular response to dexamethasone stimulus cellular response to nitric oxide potassium ion transmembrane transport metanephric descending thin limb development metanephric proximal straight tubule development metanephric proximal convoluted tubule segment 2 development metanephric proximal tubule development metanephric glomerulus vasculature development ammonium transmembrane transport hydrogen peroxide transmembrane transport cation transmembrane transport renal water homeostasis
guarantee_icon

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support