Invitrogen
Applications | Tested Dilution | Publications |
---|---|---|
Western Blot (WB) |
0.1-0.5 µg/mL | - |
Immunohistochemistry (IHC) |
- | View 1 publication 1 publication |
Immunohistochemistry (Paraffin) (IHC (P)) |
0.5-1 µg/mL | View 1 publication 1 publication |
Product Specifications | |
---|---|
Species Reactivity |
Human, Mouse, Rat |
Published species |
Not Applicable |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence at the C-terminus of human Aquaporin 1. |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Antigen affinity chromatography |
Storage buffer |
PBS with 4mg trehalose |
Contains |
no preservative |
Storage conditions |
-20°C |
RRID |
AB_2745922 |
The synthetic peptide sequence is 240-269aa, DRVKVWTSGQVEEYDLDADDINSRVEMKPK
Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.
Aquaporin 1 is a 28kD integral membrane protein which was originally identified in red blood cells and renal proximal tubules. AQP1 is also expressed by the choroid plexus and various other tissues. It forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: AQP 1; AQP CHIP; AQP-1; Aquaporin 1 (aquaporin channel forming integral protein 28 (CHIP)); aquaporin 1 (channel-forming integral protein, 28kDa, CO blood group); aquaporin 1, Colton blood group antigen; Aquaporin CHIP; Aquaporin-1; Aquaporin-CHIP; Aquaporin1; channel-like integral membrane protein, 28-kDa; CHIP 28; Colton blood group; Delayed early response protein 2; DER2; growth factor-induced delayed early response protein; MGC26324; Urine water channel; Water channel protein for red blood cells and kidney proximal tubule
Gene Aliases: AQP-CHIP; AQP1; CHIP28; CO
UniProt ID: (Human) P29972, (Mouse) Q02013, (Rat) P29975
Entrez Gene ID: (Human) 358, (Mouse) 11826, (Rat) 25240
Molecular Function:
transporter
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support