Invitrogen
This Antibody was verified by Relative expression to ensure that the antibody binds to the antigen stated.
Applications | Tested Dilution | Publications |
---|---|---|
Western Blot (WB) |
1:200-1:500 | - |
Immunohistochemistry (Frozen) (IHC (F)) |
Assay-Dependent | - |
Immunocytochemistry (ICC/IF) |
Assay-Dependent | - |
Product Specifications | |
---|---|
Species Reactivity |
Human, Mouse, Rat |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
GST fusion protein with the sequence EYVFCPDVELKRRLKEAFSK AAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGDEKKGK DSSGEVLSSV, corresponding to amino acid residues 249-323 of rat AQP4 |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
0.8 mg/mL |
Purification |
Antigen affinity chromatography |
Storage buffer |
PBS, pH 7.4, with 1% BSA |
Contains |
0.05% sodium azide |
Storage conditions |
-20°C |
RRID |
AB_2735468 |
Product is shipped at room temperature as a lyophilized powder and should be stored at -20 °C upon receipt. Reconstitution: add 50 µL of deionized water.
In skeletal muscle, AQP4 (aquaporin 4 also known as mercurial insensitive water channel), localizes to the sarcolemma of fast-twitch muscle fibers. Aquaporins (AQPs) are a large family of integral membrane water transport channel proteins that facilitate the transport of water through the cell membrane. This function is conserved in animals, plants and bacteria. Many isoforms of aquaporin have been identified in mammals, designated AQP0 through AQP10. Aquaporins are widely distributed and it is not uncommon for more than one type of AQP to be present in the same cell. Although most aquaporins are only permeable to water, AQP3, AQP7, AQP9 and one of the two AQP10 transcripts are also permeable to urea and glycerol.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: AQP-4; aquaporin type4; Aquaporin-4; Aquaporin4; HMIWC2; Mercurial-insensitive water channel; MGC22454; MIWC; WCH4
Gene Aliases: AQP-4; AQP4; MIWC; MIWC2; WCH4
UniProt ID: (Human) P55087, (Mouse) P55088, (Rat) P47863
Entrez Gene ID: (Human) 361, (Mouse) 11829, (Rat) 25293
Molecular Function:
transporter
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support