Applications | Tested Dilution | Publications |
---|---|---|
Western Blot (WB) |
0.1-0.5 µg/mL | - |
Immunohistochemistry (Paraffin) (IHC (P)) |
0.5-1 µg/mL | - |
Product Specifications | |
---|---|
Species Reactivity |
Human, Mouse, Rat |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence in the middle region of human Cytokeratin 5, different from the related mouse sequence by one amino acid, and identical to the related rat sequence. |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Affinity chromatography |
Storage buffer |
PBS with 5mg BSA |
Contains |
0.05mg sodium azide |
Storage conditions |
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
RRID |
AB_2807203 |
Synthetic peptide sequence: 286-317aa, KVELEAKVDALMDEINFMKMFFDAELSQMQTH.
Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
Cytokeratin pan is part of a subfamily of intermediate filament proteins that are characterized by remarkable biochemical diversity, and represented in human epithelial tissues by at least 20 different polypeptides. Cytokeratins range in molecular weight between 40 kDa- 68 kDa, and an isoelectric pH between 4.9-7.8. The individual human cytokeratins are numbered 1 to 20. The various epithelia in the human body usually express cytokeratins which are not only characteristic of the type of epithelium, but also related to the degree of maturation or differentiation within an epithelium. Cytokeratin subtype expression patterns are used to an increasing extent in the distinction of different types of epithelial malignancies. The cytokeratin antibodies are not only of assistance in the differential diagnosis of tumors using immunohistochemistry on tissue sections, but are also a useful tool in cytopathology and flow cytometric assays. The composition of cytokeratin pairs vary with the epithelial cell type, stage of differentiation, cellular growth environment, and disease state. Many studies have shown the usefulness of keratins as markers in cancer research and tumor diagnosis.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: 58 kDa cytokeratin; C DDD; C KRT5A; CK-5; cytokeratin 5; Cytokeratin-5; epidermolysis bullosa simplex 2 Dowling-Meara/Kobner/Weber-Cockayne types; K5; keratin 5 (epidermolysis bullosa simplex Dowling-Meara/Kobner/Weber-Cockayne types); keratin 5 (epidermolysis bullosa simplex, Dowling-Meara/Kobner/Weber-Cockayne types); keratin 5, type II; keratin complex 2, basic, gene 5; Keratin, type II cytoskeletal 5; Keratin-5; krt5; tuftelin interacting protein 8; Type-II keratin Kb5
Gene Aliases: 3300001P10Rik; AW146334; CK5; DDD; DDD1; EBS2; K5; Krt2-5; KRT5; KRT5A; Sak57; Tfip8
UniProt ID: (Human) P13647, (Rat) Q6P6Q2, (Mouse) Q922U2
Entrez Gene ID: (Human) 3852, (Rat) 369017, (Mouse) 110308
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support