Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
FIGURE: 1 / 3
GSTA1/A2/A3/A4/A5 Antibody (PA5-79336) in IHC (P)
Immunohistochemical analysis of GSTA1/A2/A3/A4/A5 in paraffin-embedded section of mouse liver tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution ) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/mL rabbit anti-GSTA1/A2/A3/A4/A5 antibody (Product # PA5-79336) overnight at 4°C. DyLight®488 Co... View More
Product Details
PA5-79336
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human GSTA1/A2/A3/A4/A5 (63-97aa MKLVQTRAILNYIASKYNLYGKDIKERALIDM YIE).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2746452
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding these enzymes are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of some drugs. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase belonging to the alpha class. The alpha class genes, located in a cluster mapped to chromosome 6, are the most abundantly expressed glutathione S-transferases in liver (hepatocytes) and kidney (proximal tubules). In addition to metabolizing bilirubin and certain anti-cancer drugs in the liver, the alpha class of these enzymes exhibit glutathione peroxidase activity, thereby protecting the cells from reactive oxygen species and the products of peroxidation.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: 13-hydroperoxyoctadecadienoate peroxidase; Androst-5-ene-3,17-dione isomerase; GHS transferase; glutathione S-alkyltransferase A1; glutathione S-alkyltransferase A2; glutathione S-alkyltransferase A3; glutathione S-alkyltransferase A4; glutathione S-aralkyltransferase A2; glutathione S-aralkyltransferase A3; glutathione S-aralkyltransferase A4; glutathione S-aryltransferase A1; glutathione S-aryltransferase A2; glutathione S-aryltransferase A3; glutathione S-aryltransferase A4; glutathione S-transferase 2; Glutathione S-transferase 5.7; Glutathione S-transferase A1; Glutathione S-transferase A2; Glutathione S-transferase A3; glutathione S-transferase A3 subunit; Glutathione S-transferase A3-3; Glutathione S-transferase A4; Glutathione S-transferase A4-4; Glutathione S-transferase A5; Glutathione S-transferase A5-5; Glutathione S-transferase alpha-1; Glutathione S-transferase alpha-2; Glutathione S-transferase alpha-3; Glutathione S-transferase alpha-4; Glutathione S-transferase alpha-5; Glutathione S-transferase GT41A; glutathione S-transferase Ha subunit 1; Glutathione S-transferase Ya; glutathione S-transferase Ya subunit; Glutathione S-transferase Ya-1; Glutathione S-transferase Ya-2; Glutathione S-transferase Ya1; Glutathione S-transferase Ya3; Glutathione S-transferase Yc; Glutathione S-transferase Yc-1; Glutathione S-transferase Yc-2; glutathione S-transferase Yc1 subunit; glutathione S-transferase Yc2 subunit; Glutathione S-transferase Yk; glutathione transferase; glutathione transferase A4-4; glutathione transferase A5; glutathione transferase YA subunit; Glutathione-S-transferase alpha type (Ya); Glutathione-S-transferase alpha type (Yc?); glutathione-S-transferase, alpha type2; GST 1-1; GST 1a-1a; GST 1b-1b; GST 2-2; GST 5.7; GST 8-8; GST A1-1; GST A2-2; GST A3-3; GST A4-4; GST A5-5; GST AA; GST B; GST class-alpha member 1; GST class-alpha member 2; GST class-alpha member 3; GST class-alpha member 4; GST class-alpha member 5; GST HA subunit 1; GST HA subunit 2; GST K; GST Ya1; GST Ya2; GST Yc1; GST Yc2; GST Yk; GST-epsilon; GST-gamma; GSTA1-1; GSTA2-2; GSTA4-4; GTH1; GTH2; Ligandin; liver GST2; S-(hydroxyalkyl)glutathione lyase A1; S-(hydroxyalkyl)glutathione lyase A2; S-(hydroxyalkyl)glutathione lyase A3; S-(hydroxyalkyl)glutathione lyase A4; testicular tissue protein Li 80; testis tissue sperm-binding protein Li 59n; uncharacterized protein LOC100042314
Gene Aliases: ENSMUSG00000074179; GST-epsilon; GST2; Gst2-1; Gst2-2; Gst2-3; GST5.7; Gsta; GSTA1; GSTA1-1; GSTA2; GSTA2-2; GSTA3; GSTA3-3; GSTA4; GSTA4-4; GSTA5; Gstc-2; Gstc2; Gstya; Gstyc; Gstyc1; Gstyc2; GTA2; GTA3; GTA4; GTH1; GTH2; mGsta4; OTTMUSG00000031890; Yc1; Yc2
glutathione metabolic process
metabolic process
epithelial cell differentiation
linoleic acid metabolic process
cellular oxidant detoxification
glutathione derivative biosynthetic process
xenobiotic metabolic process
biological_process
aging
response to nutrient levels
xenobiotic catabolic process
response to drug
aflatoxin catabolic process
response to herbicide
response to zinc ion
response to nicotine
cellular response to lithium ion
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support