Applications | Tested Dilution | Publications |
---|---|---|
Western Blot (WB) |
1:250-1:500 | - |
Immunohistochemistry (Paraffin) (IHC (P)) |
1:200 | - |
Immunocytochemistry (ICC/IF) |
1:10-1:2,000 | - |
Product Specifications | |
---|---|
Species Reactivity |
Human, Mouse |
Host/Isotype |
Mouse / IgG1 |
Class |
Monoclonal |
Type |
Antibody |
Clone |
IU5C1 |
Immunogen |
A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of the human protein. |
Conjugate |
Unconjugated |
Form |
Liquid |
Concentration |
1.0 mg/mL |
Purification |
Protein G |
Storage buffer |
PBS |
Contains |
0.1% sodium azide |
Storage conditions |
-20° C, Avoid Freeze/Thaw Cycles |
RRID |
AB_11155852 |
The target sequence has 96% sequence homology with rat, primate, and feline, 88% sequence homology with chicken, 87% sequence homology with bovine, 72% sequence homology with drosophila melanogaster.
Suggested positive control: 293 transfected lysate.
The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a multispecific organic anion transporter, with oxidized glutathione, cysteinyl leukotrienes, and activated aflatoxin B1 as substrates. This protein also transports glucuronides and sulfate conjugates of steroid hormones and bile salts. Alternative splicing by exon deletion results in several splice variants but maintains the original open reading frame in all forms.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: ATP-binding cassette sub-family C member 1; ATP-binding cassette transporter variant ABCC1delta-ex13; ATP-binding cassette transporter variant ABCC1delta-ex13&14; ATP-binding cassette transporter variant ABCC1delta-ex25; ATP-binding cassette transporter variant ABCC1delta-ex25&26; ATP-binding cassette, sub-family C (CFTR/MRP), member 1; ATP-binding cassette, sub-family C (CFTR/MRP), member 1a; ATP-binding cassette, sub-family C (CFTR/MRP), member 1b; DKFZp686N04233; DKFZp781G125; Glutathione-S-conjugate-translocating ATPase ABCC1; leuk; Leukotriene C(4) transporter; LTC4 transporter; Multidrug resistance-associated protein 1; multiple drug resistance-associated protein
Gene Aliases: ABC29; ABCC; ABCC1; Abcc1a; Abcc1b; GS-X; Mdrap; MRP; MRP1
UniProt ID: (Human) P33527, (Mouse) O35379
Entrez Gene ID: (Human) 4363, (Mouse) 17250
Molecular Function:
ATP-binding cassette (ABC) transporter
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support