Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
FIGURE: 1 / 5
RAGE Antibody (MA5-49253) in IHC (P)
Immunohistochemistry analysis of RAGE in paraffin-embedded section of mouse lung tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. Samples were incubated with RAGE Monoclonal antibody (Product # MA5-49253) using a dilution of 2 μg/mL overnight at 4°C. Peroxidase Conjugated Goat Anti-mouse IgG was use... View More
Product Details
MA5-49253
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Mouse
/ IgG2b
Class
Monoclonal
Type
Antibody
Clone
5C6C1
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human RAGE (91-120aa IQDEGIFRCQAMNRNGKETKSNYRVRVYQI).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
no preservative
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_3074911
Product Specific Information
Adding 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
Immunogen sequence is different from the related mouse and rat sequences by six amino acids.
Positive Control - WB: rat lung tissue, mouse lung tissue. IHC: mouse lung tissue, rat lung tissue, rat lung tissue. Flow: Jurkat cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
Able to phosphorylate several exogenous substrates and to undergo autophosphorylation.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: advanced glycation end-products receptor; Advanced glycosylation end product-specific receptor; advanced glycosylation end product-specific receptor variant 2; advanced glycosylation end product-specific receptor variant 3; advanced glycosylation end product-specific receptor variant 4; advanced glycosylation end product-specific receptor variant 5; RAGE isoform NtRAGE-delta; RAGE isoform sRAGE-delta; RAGE-4 ORF3; receptor for advanced glycation end-products variant 20; Receptor for advanced glycosylation end products; sRAGE
Gene Aliases: AGER; RAGE; SCARJ1
UniProt ID: (Human) Q15109, (Mouse) Q62151
Entrez Gene ID: (Human) 177, (Rat) 81722, (Mouse) 11596
regulation of T cell mediated cytotoxicity
negative regulation of protein phosphorylation
positive regulation of protein phosphorylation
negative regulation of endothelial cell proliferation
inflammatory response
negative regulation of cell adhesion
cell surface receptor signaling pathway
JAK-STAT cascade
brain development
glycoprotein metabolic process
response to wounding
response to fructose
positive regulation of autophagy
negative regulation of endothelial cell migration
positive regulation of gene expression
positive regulation of epithelial to mesenchymal transition
positive regulation of fibroblast migration
response to activity
positive regulation of smooth muscle cell migration
lung development
neuron projection development
negative regulation of interleukin-10 production
positive regulation of interleukin-12 production
negative regulation of collagen biosynthetic process
response to vitamin A
response to genistein
negative regulation of osteoblast proliferation
cellular response to drug
positive regulation of activated T cell proliferation
positive regulation of neuron apoptotic process
innate immune response
positive regulation of fibroblast proliferation
positive regulation of smooth muscle cell proliferation
positive regulation of inflammatory response
positive regulation of NF-kappaB transcription factor activity
response to methylglyoxal
calcium ion homeostasis
response to hyperoxia
positive regulation of phagocytosis, engulfment
transdifferentiation
cellular response to hydrogen peroxide
cellular response to glucose stimulus
cellular response to fatty acid
cellular response to organic cyclic compound
response to selenite ion
positive regulation of potassium ion transmembrane transporter activity
positive regulation of endothelial cell apoptotic process
positive regulation of reactive oxygen species metabolic process
regulation of CD4-positive, alpha-beta T cell activation
positive regulation of type B pancreatic cell apoptotic process
positive regulation of dendritic cell differentiation
response to hypoxia
positive regulation of cell migration
positive regulation of apoptotic process
positive regulation of JUN kinase activity
regulation of inflammatory response
induction of positive chemotaxis
regulation of DNA binding
protein localization to membrane
positive regulation of neuron death
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support