Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Promotions
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • Quick Order
          • Promos
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central
          • Primary Antibodies ›
          • TGFBR2 Antibodies

          Invitrogen

          TGFBR2 Monoclonal Antibody (2F11)

          Advanced Verification
          View all (32) TGFBR2 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Datasheet
          Certificates
          Protocols
          Questions & Answers

          Cite TGFBR2 Monoclonal Antibody (2F11)

          Additional Information:

          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (9)
          • Advanced Verification (2)
          TGFBR2 Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.
          TGFBR2 Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.

          FIGURE: 1 / 11

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          TGFBR2 Antibody (MA5-49166) in ICC/IF

          Immunocytochemistry analysis of TGFBR2 in HEPG2 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum. Samples were then incubated in TGFBR2 Monoclonal antibody (Product # MA5-49166) using a dilution of 5 μg/mL. DyLight®488 Conjugated Goat Anti-Mouse IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate ... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          TGFBR2 Antibody in Immunocytochemistry (ICC/IF)
          TGFBR2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          TGFBR2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          TGFBR2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          TGFBR2 Antibody in Western Blot (WB)
          TGFBR2 Antibody in Western Blot (WB)
          TGFBR2 Antibody in Western Blot (WB)
          TGFBR2 Antibody in Flow Cytometry (Flow)
          TGFBR2 Antibody in Flow Cytometry (Flow)
          TGFBR2 Antibody
          TGFBR2 Antibody

          Please note: We are reviewing Western blot images included in the antibody testing data in our catalog, including those provided by third parties. Unless expressly labeled or annotated as “raw-unedited”, Western blot images included in the antibody testing data in our catalog may have been edited, optimized or otherwise adjusted for presentation.

          TGFBR2 Monoclonal Antibody (2F11)

          Product Details

          MA5-49166

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.25-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          2-5 µg/mL
          -

          Immunocytochemistry (ICC/IF)

          5 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -
          Product Specifications

          Species Reactivity

          Human

          Host/Isotype

          Mouse / IgG2b

          Class

          Monoclonal

          Type

          Antibody

          Clone

          2F11

          Immunogen

          A synthetic peptide corresponding to a sequence at the N-terminus of human TGFBR2 (96-128aa TLETVCHDPKLPYHDFILEDAASPKCIMKEKKK).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          no preservative

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_3074824

          Product Specific Information

          Adding 0.2 mL of distilled water will yield a concentration of 500 µg/mL.

          Immunogen sequence different from the related mouse sequence by five amino acids, and from the related rat sequence by eight amino acids.

          Positive Control - WB: human HepG2 whole cell, human A549 whole cell, human K562 whole cell, human Caco-2 whole cell, human Hela whole cell, human T-47D whole cell. IHC: human placenta tissue, human cervical intraepithelial neoplasia tissue, human esophageal squamous carcinoma tissue. ICC/IF: HepG2 cell. Flow: A549 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          Transforming Growth Factor, beta receptor 2 (AAT3, FAA3, MFS2, RIIC, LDS1B, LDS2B, TAAD2, TGFR-2, TGFbeta-RII) is a member of the TGF-beta family of receptor Serine/Threonine kinases. It is involved in the regulation of cell proliferation. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). TGFBR2 encodes the gamma subunit of the catalytic core. Alternatively spliced transcript variants encoding different isoforms have been identified. TGFBR2 also has a pseudogene on chromosome 14.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: Ser/Thr protein kinase; tgf beta receptor 2; TGF-beta receptor type IIB; TGF-beta type II receptor; TGFbeta RII; TGFBR2-SE; TGFR2; transforming growth factor beta receptor II; transforming growth factor beta receptor II (70/80kDa) isoform TGFBR2_1; transforming growth factor beta receptor II (70/80kDa) isoform TGFBR2_2; transforming growth factor beta receptor type IIC; transforming growth factor, beta receptor II (70/80kDa); transforming growth factor, beta receptor II alpha; transforming growth factor, beta receptor II beta; transforming growth factor, beta receptor II delta; transforming growth factor, beta receptor II epsilon; transforming growth factor, beta receptor II gamma; unnamed protein product

          View more View less

          Gene Aliases: AAT3; FAA3; LDS1B; LDS2; LDS2B; MFS2; RIIC; TAAD2; tbetaR-II; TBR-ii; TBRII; TGFbeta-RII; TGFR-2

          View more View less

          UniProt ID: (Human) P37173

          View more View less

          Entrez Gene ID: (Human) 7048

          View more View less

          Function(s)
          protein kinase activity protein serine/threonine kinase activity transmembrane receptor protein serine/threonine kinase activity transforming growth factor beta-activated receptor activity transforming growth factor beta receptor activity, type II protein binding ATP binding glycosaminoglycan binding activin receptor activity, type I kinase activator activity type I transforming growth factor beta receptor binding type III transforming growth factor beta receptor binding signaling receptor activity SMAD binding metal ion binding activin binding transforming growth factor beta binding binding, bridging
          Process(es)
          blood vessel development patterning of blood vessels vasculogenesis epithelial to mesenchymal transition heart looping positive regulation of mesenchymal cell proliferation positive regulation of tolerance induction to self antigen positive regulation of B cell tolerance induction positive regulation of T cell tolerance induction outflow tract septum morphogenesis membranous septum morphogenesis outflow tract morphogenesis aortic valve morphogenesis atrioventricular valve morphogenesis tricuspid valve morphogenesis cardiac left ventricle morphogenesis endocardial cushion fusion apoptotic process transmembrane receptor protein serine/threonine kinase signaling pathway transforming growth factor beta receptor signaling pathway nervous system development brain development heart development positive regulation of cell proliferation response to xenobiotic stimulus positive regulation of epithelial to mesenchymal transition cell differentiation activin receptor signaling pathway response to lipid embryonic hemopoiesis aorta morphogenesis regulation of cell proliferation myeloid dendritic cell differentiation animal organ development blood vessel morphogenesis embryonic cranial skeleton morphogenesis artery morphogenesis positive regulation of developmental process positive regulation of NK T cell differentiation cartilage development regulation of multicellular organismal process palate development positive regulation of SMAD protein import into nucleus ventricular septum morphogenesis secondary palate development response to cholesterol cellular response to growth factor stimulus positive regulation of epithelial to mesenchymal transition involved in endocardial cushion formation cell proliferation involved in endocardial cushion morphogenesis superior endocardial cushion morphogenesis inferior endocardial cushion morphogenesis miRNA transport positive regulation of reactive oxygen species metabolic process positive regulation of CD4-positive, alpha-beta T cell proliferation regulation of stem cell differentiation
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy Consumer Health Data Privacy Policy
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Notice
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-blue-74d7b4b4d9-v4tl5:80/100.66.78.131:80.
          git-commit: 7aafa54bd143a040505a257d2a3ebda4095a617f
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.56.0-Offline