Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human TMEM119 (aa 117-167) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-101538
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
ITRQKQKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEEALD
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62661. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Tmem119 encodes a single-pass type I transmembrane protein which seems to interact with a multitude of micro-RNAs as well as certain transcription factors such as SMAD1, SMAD5 and RUNX2. Tmem119 has been identified as a surface marker of microglia that can be used to reliably distinguish microglia from infiltrating macrophages. Microglial cells are phagocytes that are restricted to the brain and involved in clearing up debris and dendrite pruning of neurons. They display a high functional plasticity, balancing neuroprotective and neurotoxic functions, which is reflected by their distinct physiology in response to changes in their microenvironment. Microglia are particularly mobile in areas of the brain undergoing restructuring. Reactive microglia co-express the marker Iba1. In a pathological context, microglia have been associated with differentiation of pathogenic/inflammatory A1 type astrocytes by secretion of Cq1, IL-1a and TNF when stimulated with LPS, and thought to contribute to the pathology of several neurodegenerative diseases such as Alzheimers, Parkinsons, Chorea Huntingtons disease and Multiple Sclerosis. The specific function Tmem119 plays on microglial cells remains unclear. Outside of the neural system, Tmem119 seems to be involved in osteoblast differentiation/ossification.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: OBIF; Osteoblast induction factor; Transmembrane protein 119
Gene Aliases: OBIF; PSEC0199; TMEM119; UNQ731/PRO1415
UniProt ID: (Human) Q4V9L6
Entrez Gene ID: (Human) 338773
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support