Search
Invitrogen
Human DFNA5 (aa 317-466) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-102091
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
VLFDDELLMVLEPVCDDLVSGLSPTVAVLGELKPRQQQDLVAFLQLVGCSLQGGCPGPEDAGSKQLFMTAYFLVSALAEMPDSAAALLGTCCKLQIIPTLCHLLRALSDDGVSDLEDPTLTPLKDTERFGIVQRLFASADISLERLKSSV
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (66%), Rat (66%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82429. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
GSDME (Gasdermin E) is a member of the gasdermin family of pore-forming proteins that regulate programmed cell death and inflammatory signaling. Encoded by the GSDME gene, the full-length protein contains an N-terminal pore-forming domain and a C-terminal autoinhibitory domain. Under apoptotic conditions, activation of caspase-3 leads to proteolytic cleavage of GSDME, releasing the N-terminal fragment, which oligomerizes and inserts into the plasma membrane to form pores. This process can convert non-lytic apoptosis into a lytic, inflammatory form of cell death resembling pyroptosis, resulting in membrane rupture and release of intracellular contents. GSDME has been implicated in cancer biology, chemotherapy response, and tissue injury, and was originally identified in association with autosomal dominant hearing loss (historically referred to as DFNA5). Detection of cleaved GSDME is commonly used as a marker of caspase-3-mediated pore formation and inflammatory cell death.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: DFNA5; DFNA5, deafness associated tumor suppressor; expression inversely correlated with estrogen receptor expression in breast cancer; Gasdermin E; Gasdermin-E; ICERE-1; Inversely correlated with estrogen receptor expression 1; Non-syndromic hearing impairment protein 5; nonsyndromic hearing impairment protein; unnamed protein product
Gene Aliases: DFNA5; GSDME; ICERE-1; ICERE1
UniProt ID: (Human) O60443
Entrez Gene ID: (Human) 1687
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support