Search
Invitrogen
Human CNDP2 (aa 23-96) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-102752
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
AKWVAIQSVSAWPEKRGEIRRMMEVAAADVKQLGGSVELVDIGKQKLPDGSEIPLPPILLGRLGSDPQKKTVCI
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83357. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
The CNDP2 gene encodes the protein carnosine dipeptidase 2, which belongs to the M20 metallopeptidase family and plays a critical role in the metabolism of dipeptides. CNDP2 is primarily involved in the hydrolysis of carnosine, a dipeptide composed of beta-alanine and histidine, and is expressed in various tissues, including the liver and kidney. This enzyme is significant in cellular processes related to nitrogen metabolism and the regulation of histidine-containing dipeptides, which have antioxidant properties influencing cellular redox balance. CNDP2 has implications in renal function and disease, where altered activity can impact the concentration of bioactive peptides involved in protective mechanisms against oxidative stress. Additionally, CNDP2 may have roles in metabolic diseases, such as diabetes and hypertension, where dipeptide regulation can influence metabolic pathways and cellular protection mechanisms. Ongoing research explores CNDP2's enzymatic activity, regulation, and potential therapeutic applications, particularly in conditions where modulation of peptide metabolism can offer clinical benefits.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: carnosinase-2; carnosine dipeptidase II; CNDP dipeptidase 2; CNDP dipeptidase 2 (metallopeptidase M20 family); Cytosolic non-specific dipeptidase; cytosolic nonspecific dipeptidase; epididymis secretory protein Li 13; Glutamate carboxypeptidase-like protein 1; Peptidase A; Threonyl dipeptidase; unnamed protein product
Gene Aliases: CN2; CNDP2; CPGL; HEL-S-13; HsT2298; PEPA
UniProt ID: (Human) Q96KP4
Entrez Gene ID: (Human) 55748
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support