Search
Invitrogen
Human BTF3L4 (aa 111-142) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-103646
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
TSLRKLAEQFPRQVLDSKAPKPEDIDEEDDDV
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64303. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
The initiation of gene transcription involves the ordered assembly of a multiprotein complex on proximal promoter elements such as the TATA box. In addition to RNA polymerase II (Pol II), the transcription factor class II (TFII) family of proteins are required for initiation of transcription, as the first step in the formation of this initiation complex is the stable binding of TFIID to the TATA box. An additional TFII-related protein, BTF3, does not directly associate with the proximal promoter, but rather forms a stable complex with Pol II and facilitates Pol II assembly into the complex. The BTF3 gene is ubiquitously expressed and encodes two protein isoforms, BTF3a and BTF3b, which are produced from alternative splicing. The BTF3 proteins are identical, except that BTF3b lacks the first 44 amino acids at the N-terminal of BTF3a. As a consequence of this deletion, BTF3b is unable to induce transcription, despite being able to bind Pol II. Additionally, BTF3a and BTF3b associate with the widely expressed protein kinase casein kinase II. Casein kinase II phosphorylates BTF3a, as well as TFIIB, and is required for the efficient transcription of the tRNA and 55 rRNA genes by Pol III. BTF3 belongs to the NAC-beta family, which includes several related proteins, such as BTF3L1, BTF3L2, BTF3L3 and BTF3L4.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Basic transcription factor 3-like 4; Transcription factor BTF3 homolog 4; unnamed protein product
Gene Aliases: BTF3L4
UniProt ID: (Human) Q96K17
Entrez Gene ID: (Human) 91408
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support