Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human NR4A1 (aa 96-182) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-105137
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
PASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASG
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111494. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
NR4A1 is a member of the steroid-thyroid hormone-retinoid receptor superfamily. NGFI-B-alpha is expressed in brain, adrenal, thyroid, liver, testis, ovary, thymus, muscle, lung and prostate. Its expression is induced in response to various stress stimuli and growth factors. The encoded protein acts as a nuclear transcription factor involved in mediating apoptotic signaling in thymocytes and tumor cells, as well as having a role in signaling in the hypothalamic-pituitary axis. Translocation of the protein from the nucleus to mitochondria induces apoptosis. Three transcript variants encoding two distinct isoforms have been identified for this NR4A1. Variant (3), also known as TRC beta, contains multiple differences compared to variant 1. The resulting isoform b contains a shorter and distinct C-terminus compared to isoform a. RXR has been shown to be a partner for NR4A1.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Early response protein NAK1; growth factor-inducible nuclear protein N10; hormone receptor; MGC9485; nerve growth factor IB nuclear receptor variant 1; Nuclear hormone receptor NUR/77; nuclear receptor subfamily 4, group A, member 1; Nuclear receptor subfamily 4immunitygroup A member 1; Nur77; Orphan nuclear receptor HMR; Orphan nuclear receptor TR3; Orphan receptor tr3; ST-59; steroid receptor TR3; Testicular receptor 3; TR3 orphan receptor
Gene Aliases: GFRP1; HMR; N10; NAK-1; NAK1; NGFIB; NP10; NR4A1; NUR77; TR3
UniProt ID: (Human) P22736
Entrez Gene ID: (Human) 3164
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support