Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human MMP8 (aa 32-98) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-92869
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
TVQDYLEKFYQLPSNQYQSTRKNGTNVIVEKLKEMQRFFGLNVTGKPNEETLDMMKKPRCGVPDSGG
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (57%), Rat (57%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82805. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
The MMP8 gene encodes matrix metalloproteinase-8, also known as collagenase-2, an enzyme belonging to the matrix metalloproteinase (MMP) family, which plays a pivotal role in the breakdown of extracellular matrix (ECM) components. MMP8 is primarily involved in the degradation of type I and III collagen, facilitating tissue remodeling and repair processes. This enzyme is produced by neutrophils and is active in areas of tissue inflammation and injury, where it modulates the ECM to aid in wound healing. MMP8 is implicated in various physiological processes, including embryonic development, angiogenesis, and bone remodeling. However, excessive or unregulated activity of MMP8 can lead to pathological conditions such as arthritis, periodontal disease, and cancer metastasis, where ECM degradation contributes to disease progression. Research into MMP8 aims to understand its regulation and involvement in disease states, providing insights into potential therapeutic strategies for targeting MMP activity in inflammatory and degenerative conditions.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Collagenase; collagenase 2; matrix metallo protease; matrix metalloproteinase 8 (neutrophil collagenase); Matrix metalloproteinase-8; Matrix metalloproteinase8; MMP; MMP 8; MMP-8; MMPs; Neutrophil collagenase; PMN leukocyte collagenase; PMNL CL; PMNL collagenase; PMNL-CL; PMNLCL
Gene Aliases: CLG1; HNC; MMP-8; MMP8; PMNL-CL
UniProt ID: (Human) P22894
Entrez Gene ID: (Human) 4317
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support