Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human DPPA2 (aa 102-183) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-96402
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
DWCQQLGLSTNGKKIEVYLRLHRHAYPEQRQDMPEMSQETRLQRCSRKRKAVTKRARLQRSYEMNERAEETNTVEVITSAPG
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (37%), Rat (37%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57536. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
The DPPA2 (Developmental Pluripotency Associated 2) gene is prominently expressed in embryonic stem cells and is critical for maintaining their pluripotency and self-renewal capabilities. Located on chromosome 3, DPPA2 belongs to a family of genes that play significant roles in early embryonic development and epigenetic remodeling. The expression of DPPA2 is tightly regulated through mechanisms such as DNA methylation, and it is involved in regulatory pathways that control the expression of core pluripotency factors. Beyond its role in stem cell biology, DPPA2 expression is also noted in various cancers, where it can become reactivated, suggesting its involvement in oncogenic processes. In the context of cancer, DPPA2, along with DPPA4, has been studied for its potential to facilitate cellular reprogramming and contribute to tumorigenesis. Given its expression pattern, DPPA2 serves as both a marker of pluripotent potential in stem cells and a potential target for cancer diagnostics and therapy due to its reactivation in malignant tissues.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: cancer/testis antigen 100; Developmental pluripotency-associated protein 2; ECSA; embryonic stem cell (ESC) associated transcript 15-2; Pluripotent embryonic stem cell-related gene 1 protein
Gene Aliases: CT100; DPPA2; ECAT15-2; PESCRG1
UniProt ID: (Human) Q7Z7J5
Entrez Gene ID: (Human) 151871
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support