Search Thermo Fisher Scientific
Search Thermo Fisher Scientific
PA1-28315 detects ICA1L from human samples.
PA1-28315 has been successfully used in Western blot applications.
The PA1-28315 immunogen is: Fusion protein: levfhsvqetctellkiiekyqlrlnviseeenelglflkfqaerdatqagkmmdatgkalcssakqrlalctplsrlkqevatfsqravsdtlmt, corresponding to amino acids 53-148 of Human Ica69-related protein/LOC130026.
ICA1L is a protein coding gene and gene ontology (GO) annotation includes acrosomal vesicle; protein domain specific binding; spermatid development.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: amyotr; amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 14; amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 15; Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 14 protein; Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 15 protein; Ica69-related protein; islet cell autoantigen 1,69kDa-like; Islet cell autoantigen 1-like protein
Gene Aliases: ALS2CR14; ALS2CR15; ICA1L
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support