Hamburger Menu Button
Thermo Fisher Scientific Logo
Iniciar sesión
¿No tiene una cuenta? Crear una cuenta
  • Productos
    • Consumibles de laboratorio
    • Equipos de laboratorio
    • Instrumentos de Laboratorio
    • Clínica y Diagnóstico
    • Cromatografía
    • Espectrometría de Masas
    • Cultivo Celular
    • Análisis Celular
    • Anticuerpos
    • Ver todas las categorías de producto
  • Aplicaciones
    • Cultivo celular y transfección
    • Citometría de flujo
    • Investigación sobre el cáncer
    • Cromatografía
    • Secuenciación
    • PCR
    • Soluciones para laboratorio
    • Diagnóstico de alergias
    • Ver todas las aplicaciones y técnicas
  • Servicios
    • Servicios Personalizados
    • Servicios de Capacitación
    • Informática para laboratorios de ámbito empresarial
    • Servicios financieros y de arrendamiento
    • Servicios 360° de CDMO y CRO
    • Servicios de CDMO
    • Servicios de CRO
    • Inspección de seguridad alimentaria Servicios
    • Ver todos los servicios
  • Ayuda y Soporte
    • Crear una nueva cuenta
    • Cómo hacer el pedido
    • Póngase en contacto con nosotros
    • Cambio de ubicación
    • Ver toda la ayuda y soporte técnico
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • A quiénes brindamos nuestros servicios
    • Industria biotecnológica
    • Sector biofarmacéutico
    • CDMO
    • Diagnósticos de laboratorio
    • Ciencias aplicadas e industriales
  • Ofertas especiales
  • Contáctenos
  • Orden Rápida
  • Documentos y certificados
Thermo Fisher Scientific Logo

Search

Buscar
Search button
          • Contáctenos
          • Orden Rápida
          • Iniciar sesión
            Iniciar sesión
            ¿No tiene una cuenta? Crear una cuenta
            • Cuenta
            • Estatus del pedido
            • Productos personalizados y proyectos​
          • Primary Antibodies ›
          • DOG-1 Antibodies

          NeoBiotechnologies

          DOG-1/ANO1 (Marker for Gastrointestinal Stromal Tumors) Monoclonal Antibody (DG1/447, DOG-1.1)

          View all (57) DOG-1 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite DOG-1/ANO1 (Marker for Gastrointestinal Stromal Tumors) Monoclonal Antibody (DG1/447, DOG-1.1)

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (1)
          DOG-1/ANO1 (Marker for Gastrointestinal Stromal Tumors) Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          DOG-1/ANO1 (Marker for Gastrointestinal Stromal Tumors) Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 1

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          DOG-1/ANO1 (Marker for Gastrointestinal Stromal Tumors) Antibody (55107-MSM3-P1) in IHC (P)

          Formalin-fixed, paraffin-embedded human GIST stained with DOG-1 Monoclonal Antibody (DG1/447 +DOG1.1). {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          DOG-1/ANO1 (Marker for Gastrointestinal Stromal Tumors) Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          DOG-1/ANO1 (Marker for Gastrointestinal Stromal Tumors) Monoclonal Antibody (DG1/447, DOG-1.1)

          Product Details

          55107-MSM3-P1

          Applications
          Tested Dilution
          Publications

          Immunohistochemistry (Paraffin) (IHC (P))

          Assay-dependent
          -

          Immunohistochemistry (PFA fixed) (IHC (PFA))

          1-2 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human

          Host/Isotype

          Mouse / IgG1, kappa

          Class

          Monoclonal

          Type

          Antibody

          Clone

          DG1/447, DOG-1.1

          Immunogen

          Recombinant human DOG-1 protein (DG1/447) + A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1).
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Liquid

          Concentration

          200 µg/mL

          Amount

          100 µg

          Purification

          Protein A/G

          Storage buffer

          PBS, pH 7.4, with 0.05% BSA

          Contains

          0.05% sodium azide

          Storage conditions

          4°C, do not freeze

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          Target Information

          DOG-1, the novel marker, is expressed ubiquitously in gastrointestinal stromal tumors irrespective of kit or PDGFR alpha mutation status.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: Ano1; anoctamin 1, calcium activated chloride channel; Anoctamin-1; Ca2+-activated Cl- channel; cacium activated chloride channel; calcium activated chloride channel; Discovered on gastrointestinal stromal tumors protein 1; FLJ10261; membrane protein; oral cancer overexpressed 2; Oral cancer overexpressed protein 2; Transmembrane protein 16A; transmembrane protein 16A (eight membrane-spanning domains); Tumor-amplified and overexpressed sequence 2; unnamed protein product

          View more View less

          Gene Aliases: ANO1; DOG1; INDMS; MYMY7; ORAOV2; TAOS2; TMEM16A

          View more View less

          UniProt ID: (Human) Q5XXA6

          View more View less

          Entrez Gene ID: (Human) 55107

          View more View less

          Function(s)
          receptor binding calcium activated cation channel activity intracellular calcium activated chloride channel activity voltage-gated chloride channel activity chloride channel activity protein binding iodide transmembrane transporter activity identical protein binding protein homodimerization activity metal ion binding protein dimerization activity
          Process(es)
          ion transport chloride transport phospholipase C-activating G-protein coupled receptor signaling pathway iodide transport ion transmembrane transport cellular response to heat detection of temperature stimulus involved in sensory perception of pain mucus secretion protein localization to membrane cation transmembrane transport glial cell projection elongation cellular response to peptide chloride transmembrane transport
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Pedidos Plus Icon Minus Icon
          • Estatus del pedido
          • Ayuda para pedidos
          • Orden Rápida
          • Supply Center
          • eProcurement
          Soporte Plus Icon Minus Icon
          • Ayuda y soporte
          • Entre en Contacto
          • Centros de asistencia técnica
          • Consultar documentos y certificados
          • Informar de un problema en la web
          Recursos Plus Icon Minus Icon
          • Centros de aprendizaje
          • Promociones
          • Eventos & Webinars
          • Medios Sociales
          Acerca de Thermo Fisher Plus Icon Minus Icon
          • Acerca de nosotros Acerca de nosotros
          • Empleo Empleo
          • Inversores Inversores
          • Noticias Noticias
          • Responsabilidad social Responsabilidad social
          • Marcas comerciales
          • Políticas y avisos
          Nuestro Portafolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          México flag icon
          México

          Your items have has been added!


          Host server : magellan-search-blue-64dd947b88-fbg7s:80/100.66.79.246:80.
          git-commit: 0f46c0ba67a87c24f5ac662a3edafcaba07cd08c
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.45.0-Offline