Hamburger Menu Button
Thermo Fisher Scientific Logo
로그인
회원이 아니신가요? 계정 생성하기
  • 모든 제품 주문
    • 항체
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR 분석
    • 피펫 및 피펫 팁
    • 실험실용 원심분리기
    • 초저온 냉동고
    • 분광학
    • 비이커
    • PCR 장비 및 용품
    • 제품 카테고리 전체보기
  • 응용 분야 및 기법
    • 세포 분석
    • 실험실 장비
    • Real-Time PCR
    • PCR
    • 크로마토그래피
    • 세포 배양 및 트랜스펙션
    • DNA/RNA 추출과 분석
    • 단백질 생물학
    • 유세포분석
    • 화학 제품
    • 응용 분야 및 기법 전체보기
  • 서비스
    • 맞춤형 서비스
    • 엔터프라이즈급 실험실 정보 처리
    • 360° CDMO 및 CRO 서비스
    • CDMO 서비스
    • 임상시험 CRO 서비스
    • 장비 서비스
    • 교육 서비스
    • Unity Lab Services
    • 서비스 전체 보기
  • 지원
    • 고객센터
    • 문의하기
    • 시험성적서(COA) 및 적합성 인증서(COC)
    • Safety Data Sheets (SDS)
    • 매뉴얼
    • 인용 및 참고 문헌
    • 기기 지원
    • 기술 자료/제품 FAQ
    • 학습 센터
    • 지원 메뉴 전체보기
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • 문의하기
  • 빠른 주문
  • 주문 현황
  • 제품 문서 검색
Thermo Fisher Scientific Logo

Search

전체검색
Search button
          • 주문 현황
          • 빠른주문
          • 로그인
            로그인
            회원이 아니신가요? 계정 생성하기
            • 계정정보
            • 주문내역조회
            • 커스텀제품 및 프로젝트
            • Services Central
          • Primary Antibodies ›
          • ACTH Antibodies

          Fabgennix

          ACTH Polyclonal Antibody, Biotin

          View all (45) ACTH antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite ACTH Polyclonal Antibody, Biotin

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          ACTH Polyclonal Antibody, Biotin

          Product Details

          ACTH-BIOTIN

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          1:500-1:1,000
          -

          Immunohistochemistry (IHC)

          1:50-1:250
          -

          Immunocytochemistry (ICC/IF)

          1:50-1:250
          -

          ELISA (ELISA)

          1:10,000
          -

          Immunoprecipitation (IP)

          1:100-1:250
          -

          Dot blot (DB)

          1:10,000
          -

          Immunomicroscopy (IM)

          1:50-1:200
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Non-human primate, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          Synthetic peptide corresponding to ACTH aa 138-176. Sequence:SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
          View immunogen

          Conjugate

          Biotin Biotin Biotin

          Form

          Liquid

          Concentration

          0.5-1.5 mg/mL

          Purification

          Affinity chromatography

          Storage buffer

          proprietary buffer, pH 7.4-7.8, with 30% glycerol, 0.5% BSA

          Contains

          0.02% sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          Target Information

          ATCH (adrenocorticotropic hormone) is a hormone which plays a major role in stimulating the adrenal cortex. It is formed through cleavage of the polypeptide precursor proopiomelanocortin (POMC), which also results in several other cleavage products including MSH, ACTH, and beta endorphin. ATCH is secreted from the anterior pituitary in response to the corticotropin-releasing hormone from the hypothalamus. It stimulates the secretion of glucocorticoids like cortisol, but has little control over the stimulation of mineralocorticoids like aldosterone, which is another major hormone of the adrenal cortex.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: adrenal corticotropic hormone; adrenocorticotropic hormone; adrenocorticotropin; alpha-melanocyte stimulating hormone; alpha-melanocyte-stimulating hormone; alpha-MSH; beta-endorphin; beta-LPH; beta-melanocyte-stimulating hormone; beta-MSH; corticotropin-like intermediary peptide; Corticotropin-lipotropin; gamma-LPH; gamma-MSH; lipotropin beta; lipotropin gamma; melanotropin alpha; melanotropin beta; melanotropin gamma; met-enkephalin; opiomelanocortin prepropeptide; OTTHUMP00000119991; OTTHUMP00000200964; POMC; Precursor of MSH; pro-ACTH-endorphin; Pro-opiomelanocortin; pro-opiomelanocortin-alpha; proopiomelanocortin (adrenocorticotropin/ beta-lipotropin/ alpha-melanocyte stimulating hormone/ beta-melanocyte stimulating hormone/ beta-endorphin); proopiomelanocortin precursor; proopiomelanocortin preproprotein; proopiomelanocortin, beta (endorphin, beta); proopoimelanocortin, beta (endorphin, beta)

          View more View less

          Gene Aliases: ACTH; alpha-MSH; alphaMSH; BE; Beta-LPH; beta-MSH; CLIP; Gamma-LPH; gamma-MSH; LPH; MSH; NPP; OBAIRH; POC; POMC; Pomc-1; Pomc1; Pomc2

          View more View less

          UniProt ID: (Human) P01189, (Mouse) P01193

          View more View less

          Entrez Gene ID: (Human) 5443, (Mouse) 18976, (Rat) 24664

          View more View less

          Function(s)
          G-protein coupled receptor binding receptor binding hormone activity protein binding type 3 melanocortin receptor binding type 4 melanocortin receptor binding type 1 melanocortin receptor binding molecular_function
          Process(es)
          generation of precursor metabolites and energy signal transduction neuropeptide signaling pathway cell-cell signaling regulation of blood pressure calcium-mediated signaling killing of cells of other organism regulation of appetite negative regulation of tumor necrosis factor production cellular pigmentation modification of morphology or physiology of other organism glucose homeostasis positive regulation of transcription from RNA polymerase II promoter antimicrobial humoral immune response mediated by antimicrobial peptide regulation of glycogen metabolic process positive regulation of neutrophil mediated killing of fungus positive regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway positive regulation of oxytocin production response to melanocyte-stimulating hormone regulation of corticosterone secretion feeding behavior
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          온라인 주문 Plus Icon Minus Icon
          • 주문 현황
          • 주문 지원
          • 빠른 주문
          • Supply Center
          • eProcurement
          지원 Plus Icon Minus Icon
          • Help and Support
          • 고객 센터
          • 기술 지원 센터
          • 제품 문서 검색
          • 사이트 문제 보고
          교육 및 이벤트 Plus Icon Minus Icon
          • 교육 센터
          • 프로모션
          • 이벤트 및 웨비나
          • 소셜 미디어
          About Thermo Fisher Plus Icon Minus Icon
          • 소개 소개
          • 채용 채용
          • 투자자 투자자
          • 뉴스 뉴스
          • 사회적 책임 사회적 책임
          • Trademarks
          • 공정거래 공정거래
          • 정책 및 고지
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • 이용 약관
          • 개인정보 처리방침
          • 가격 및 운임 정책
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Korea flag icon
          Korea

          고객센터 문의 | 평일 09:00~18:00
          1661-9555   |   Live Chat   |   카카오톡 상담

           

          장비 서비스 문의 | 평일 09:00~18:00
          1661-5055   |   Live Chat

          고객센터 문의 | 평일 09:00~18:00
          1661-9555   |   Live Chat   |   카카오톡 상담

           

          장비 서비스 문의 | 평일 09:00~18:00
          1661-5055   |   Live Chat

          고객센터 문의 | 평일 09:00~18:00
          1661-9555   |   Live Chat   |   카카오톡 상담

           

          장비 서비스 문의 | 평일 09:00~18:00
          1661-5055   |   Live Chat

          써모 피셔 사이언티픽 코리아 주식회사
          대표자 : 석수진
          사업자 등록번호 : 117-81-46910
          입금계좌 : 하나은행 336-890014-06204
          (예금주 : 써모피셔사이언티픽코리아 주식회사)

           

          써모 피셔 사이언티픽 솔루션스 유한회사
          대표자 : 석수진
          사업자 등록번호 : 114-86-04783
          입금계좌 : 신한은행 140-004-396660
          (예금주 : 써모피셔사이언티픽솔루션스 유한회사)

           

          주소 : 서울시 강남구 광평로 281 수서오피스빌딩 12층 06349 | 통신판매업신고번호 : 2015-서울강남-00898

          ISMS Logo

          Your items have has been added!


          Host server : magellan-search-blue-64dd947b88-fbg7s:80/100.66.79.246:80.
          git-commit: 0f46c0ba67a87c24f5ac662a3edafcaba07cd08c
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.45.0-Offline