Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Cell Analysis
    • Antibodies
    • Mass Spectrometry
    • Cell Culture
    • Laboratory Instruments
    • Clinical and Diagnostics
    • Chromatography
    • Laboratory Equipment
    • Laboratory Supplies
    • Molecular Biology and Nucleic Acid Analysis
    • Sequence-Specific Nucleic Acid Products
    • See all product categories
  • Applications
    • Cell Culture and Transfection
    • Flow Cytometry
    • Cancer Research
    • Chromatography
    • Sequencing
    • PCR
    • Lab Solutions
    • Allergy Diagnostics
    • See all applications and techniques
  • Services
    • Cell Biology Services
    • Custom Services
    • Training Services
    • Lab Informatics Services
    • Financial and Leasing Services
    • Partnering and Licensing Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Food Safety Inspection Services
    • See all services
  • Help and Support
    • How to Order
    • Promotions and Online Offers
    • Contact Us
    • Change Location
    • Create a New Account
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Special Offers
  • Contact Us
  • Quick Order
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Contact Us
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Custom Products & Projects
          • Primary Antibodies ›
          • ACTH Antibodies

          Fabgennix

          ACTH Polyclonal Antibody, FITC

          View all (48) ACTH antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite ACTH Polyclonal Antibody, FITC

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (1)
          ACTH Antibody in Western Blot (WB)
          Group 53 Created with Sketch.
          ACTH Antibody in Western Blot (WB)
          Group 53 Created with Sketch.

          FIGURE: 1 / 1

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          ACTH Antibody (ACTH-FITC) in WB

          Slot blot of ACTH with ACTH-101AP. Varying concentration of ACTH was blotted on Nitrocellulose and probed at 1:500 antibody dilution in DiluObuffer. {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          ACTH Antibody in Western Blot (WB)
          ACTH Polyclonal Antibody, FITC

          Product Details

          ACTH-FITC

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          1:500-1:1,000
          -

          Immunohistochemistry (IHC)

          1:50-1:250
          -

          Immunocytochemistry (ICC/IF)

          1:50-1:250
          -

          ELISA (ELISA)

          1:10,000
          -

          Immunoprecipitation (IP)

          1:100-1:250
          -

          Dot blot (DB)

          1:10,000
          -

          Immunomicroscopy (IM)

          1:50-1:200
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Non-human primate, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          Synthetic peptide corresponding to ACTH aa 138-176. Sequence:SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
          3D Epitope / Immunogen

          Conjugate

          FITC FITC FITC

          Excitation/Emission Max

          498/517 nm View spectra spectra

          Form

          Liquid

          Concentration

          0.5-1.5 mg/mL

          Purification

          Affinity chromatography

          Storage buffer

          proprietary buffer, pH 7.4-7.8, with 30% glycerol, 0.5% BSA

          Contains

          0.02% sodium azide

          Storage conditions

          -20°C, store in dark

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          Target Information

          ATCH (adrenocorticotropic hormone) is a hormone which plays a major role in stimulating the adrenal cortex. It is formed through cleavage of the polypeptide precursor proopiomelanocortin (POMC), which also results in several other cleavage products including MSH, ACTH, and beta endorphin. ATCH is secreted from the anterior pituitary in response to the corticotropin-releasing hormone from the hypothalamus. It stimulates the secretion of glucocorticoids like cortisol, but has little control over the stimulation of mineralocorticoids like aldosterone, which is another major hormone of the adrenal cortex.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: adrenal corticotropic hormone; adrenocorticotropic hormone; adrenocorticotropin; alpha-melanocyte stimulating hormone; alpha-melanocyte-stimulating hormone; alpha-MSH; beta-endorphin; beta-LPH; beta-melanocyte-stimulating hormone; beta-MSH; corticotropin-like intermediary peptide; Corticotropin-lipotropin; gamma-LPH; gamma-MSH; lipotropin beta; lipotropin gamma; melanotropin alpha; melanotropin beta; melanotropin gamma; met-enkephalin; opiomelanocortin prepropeptide; OTTHUMP00000119991; OTTHUMP00000200964; POMC; Precursor of MSH; pro-ACTH-endorphin; Pro-opiomelanocortin; pro-opiomelanocortin-alpha; proopiomelanocortin (adrenocorticotropin/ beta-lipotropin/ alpha-melanocyte stimulating hormone/ beta-melanocyte stimulating hormone/ beta-endorphin); proopiomelanocortin precursor; proopiomelanocortin preproprotein; proopiomelanocortin, beta (endorphin, beta); proopoimelanocortin, beta (endorphin, beta)

          View more View less

          Gene Aliases: ACTH; alpha-MSH; alphaMSH; BE; Beta-LPH; beta-MSH; CLIP; Gamma-LPH; gamma-MSH; LPH; MSH; NPP; OBAIRH; POC; POMC; Pomc-1; Pomc1; Pomc2

          View more View less

          UniProt ID: (Human) P01189, (Mouse) P01193

          View more View less

          Entrez Gene ID: (Human) 5443, (Mouse) 18976, (Rat) 24664

          View more View less

          Function(s)
          G-protein coupled receptor binding receptor binding hormone activity protein binding type 3 melanocortin receptor binding type 4 melanocortin receptor binding type 1 melanocortin receptor binding molecular_function
          Process(es)
          generation of precursor metabolites and energy signal transduction neuropeptide signaling pathway cell-cell signaling regulation of blood pressure calcium-mediated signaling killing of cells of other organism regulation of appetite negative regulation of tumor necrosis factor production cellular pigmentation modification of morphology or physiology of other organism glucose homeostasis positive regulation of transcription from RNA polymerase II promoter antimicrobial humoral immune response mediated by antimicrobial peptide regulation of glycogen metabolic process positive regulation of neutrophil mediated killing of fungus positive regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway positive regulation of oxytocin production response to melanocyte-stimulating hormone regulation of corticosterone secretion feeding behavior
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Responsibility Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          México flag icon
          México

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-8dsbr:80/100.66.76.150:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline