Applications | Tested Dilution | Publications |
---|---|---|
Immunohistochemistry (Paraffin) (IHC (P)) |
0.5-1 µg/mL | - |
Product Specifications | |
---|---|
Species Reactivity |
Human, Mouse, Rat |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence in the middle region of human ACTH, different from the related mouse and rat sequences by two amino acids. |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Affinity chromatography |
Storage buffer |
PBS with 5mg BSA |
Contains |
0.05mg sodium azide |
Storage conditions |
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
RRID |
AB_2806982 |
Synthetic peptide sequence: 138-176aa, SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF.
Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
ATCH (adrenocorticotropic hormone) is a hormone which plays a major role in stimulating the adrenal cortex. It is formed through cleavage of the polypeptide precursor proopiomelanocortin (POMC), which also results in several other cleavage products including MSH, ACTH, and beta endorphin. ATCH is secreted from the anterior pituitary in response to the corticotropin-releasing hormone from the hypothalamus. It stimulates the secretion of glucocorticoids like cortisol, but has little control over the stimulation of mineralocorticoids like aldosterone, which is another major hormone of the adrenal cortex.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: ACTH; adrenal corticotropic hormone; Adrenocorticotropic hormone; adrenocorticotropin; alpha-melanocyte stimulating hormone; alpha-melanocyte-stimulating hormone; Alpha-MSH; Beta-endorphin; Beta-LPH; beta-melanocyte-stimulating hormone; Beta-MSH; CLIP; Corticotropin; Corticotropin-like intermediary peptide; Corticotropin-lipotropin; Gamma-LPH; Gamma-MSH; Lipotropin beta; Lipotropin gamma; Melanocyte-stimulating hormone alpha; Melanocyte-stimulating hormone beta; Melanotropin alpha; Melanotropin beta; Melanotropin gamma; Met-enkephalin; NPP; opiomelanocortin prepropeptide; OTTHUMP00000119991; OTTHUMP00000200964; POMC; Potential peptide; Precursor of MSH; pro-ACTH-endorphin; Pro-opiomelanocortin; pro-opiomelanocortin-alpha; proopiomelanocortin (adrenocorticotropin/ beta-lipotropin/ alpha-melanocyte stimulating hormone/ beta-melanocyte stimulating hormone/ beta-endorphin); proopiomelanocortin preproprotein; proopiomelanocortin, beta (endorphin, beta); proopoimelanocortin, beta (endorphin, beta)
Gene Aliases: ACTH; alpha-MSH; alphaMSH; BE; Beta-LPH; beta-MSH; CLIP; Gamma-LPH; gamma-MSH; LPH; MSH; NPP; POC; POMC; Pomc-1; Pomc1; Pomc2
UniProt ID: (Human) P01189, (Mouse) P01193
Entrez Gene ID: (Human) 5443, (Mouse) 18976, (Rat) 24664
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support