Search
Invitrogen
ACVR2B Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
FIGURE: 1 / 1
ACVR2B Antibody (PA5-95362) in WB
Western blot analysis of ACVR2B in rat skeletal muscle extract (lane 1) and MCF-7 whole cell lysates (lane 2). Samples were incubated with ACVR2B polyclonal antibody (Product # PA5-95362) using a 0.5 µg/mL dilution. developed was performed using enhanced chemiluminescence (ECL).
Product Details
PA5-95362
Product Specifications
Species Reactivity
Human,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human ACVR2B (431-466aa VVHKKMRPTIKDHWLKHPGLAQLCVTIEECWDHDAE).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Amount
100 µg
Purification
Affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.01mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: rat skeletal muscle tissue, MCF-7 whole cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
ACVR2B is a type II member of the TGF-beta family of receptor ser/thr kinases and is involved in the activin and myostatin signaling pathway. Activins and inhibins are members of the TGF-beta superfamily due to amino acid homology with respect to the conservation of 7 of the 9 cysteine residues common to all TGF-beta forms. To date, seven type I and five type II activin receptors have been cloned from mammals, including activin receptor IA, activin receptor IIA, activin receptor IB, and activin receptor IIB. In addition, two splice variants of activin receptor IIA and five splice variants of activin receptor IIB have been reported.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: activin A receptor, type IIB; activin receptor IIB; Activin receptor type IIB; Activin receptor type-2B; Activine receptor 2b (transmembrane serine kinase); ACTR-IIB; ActRIIB type II activin receptor B; MGC116908; probable match to ACTIVIN RECEPTOR TYPE IIB PRECURSOR (ACTR-IIB)
Gene Aliases: ActR-IIB; ACTRIIB; ACVR2B; HTX4
UniProt ID: (Human) Q13705, (Rat) P38445
Entrez Gene ID: (Human) 93, (Rat) 25366
nucleotide binding
protein kinase activity
protein serine/threonine kinase activity
transmembrane receptor protein serine/threonine kinase activity
protein serine/threonine/tyrosine kinase activity
protein binding
ATP binding
kinase activity
activin receptor activity, type II
transferase activity
activin-activated receptor activity
kinase activator activity
growth factor binding
metal ion binding
activin binding
receptor signaling protein serine/threonine kinase activity
transforming growth factor beta-activated receptor activity
inhibin binding
transforming growth factor beta binding
serine/threonine protein kinase receptor
negative regulation of transcription from RNA polymerase II promoter
skeletal system development
gastrulation with mouth forming second
kidney development
lymphangiogenesis
blood vessel remodeling
regulation of transcription, DNA-templated
cellular iron ion homeostasis
signal transduction
transmembrane receptor protein serine/threonine kinase signaling pathway
determination of left/right symmetry
pattern specification process
mesoderm development
heart development
response to glucose
post-embryonic development
anterior/posterior pattern specification
regulation of signal transduction
insulin secretion
negative regulation of ossification
lung development
positive regulation of bone mineralization
BMP signaling pathway
pancreas development
developmental process
activin receptor signaling pathway
positive regulation of activin receptor signaling pathway
organ growth
odontogenesis of dentin-containing tooth
positive regulation of osteoblast differentiation
embryonic foregut morphogenesis
skeletal system morphogenesis
palate development
lymphatic endothelial cell differentiation
artery development
venous blood vessel development
retina vasculature development in camera-type eye
trophoblast cell migration
cellular response to growth factor stimulus
negative regulation of cold-induced thermogenesis
negative regulation of adipose tissue development
protein phosphorylation
sexual reproduction
signal transduction by protein phosphorylation
activation of protein kinase activity
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support