Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Promotions
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • Quick Order
          • Promos
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central
          • Primary Antibodies ›
          • ACVR2B Antibodies

          Invitrogen

          ACVR2B Polyclonal Antibody

          View all (21) ACVR2B antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite ACVR2B Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (1)
          ACVR2B Antibody in Western Blot (WB)
          Group 53 Created with Sketch.
          ACVR2B Antibody in Western Blot (WB)
          Group 53 Created with Sketch.

          FIGURE: 1 / 1

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          ACVR2B Antibody (PA5-95362) in WB

          Western blot analysis of ACVR2B in rat skeletal muscle extract (lane 1) and MCF-7 whole cell lysates (lane 2). Samples were incubated with ACVR2B polyclonal antibody (Product # PA5-95362) using a 0.5 µg/mL dilution. developed was performed using enhanced chemiluminescence (ECL). {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          ACVR2B Antibody in Western Blot (WB)
          ACVR2B Polyclonal Antibody

          Product Details

          PA5-95362

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human ACVR2B (431-466aa VVHKKMRPTIKDHWLKHPGLAQLCVTIEECWDHDAE).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.01mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2807165

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: rat skeletal muscle tissue, MCF-7 whole cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          ACVR2B is a type II member of the TGF-beta family of receptor ser/thr kinases and is involved in the activin and myostatin signaling pathway. Activins and inhibins are members of the TGF-beta superfamily due to amino acid homology with respect to the conservation of 7 of the 9 cysteine residues common to all TGF-beta forms. To date, seven type I and five type II activin receptors have been cloned from mammals, including activin receptor IA, activin receptor IIA, activin receptor IB, and activin receptor IIB. In addition, two splice variants of activin receptor IIA and five splice variants of activin receptor IIB have been reported.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: activin A receptor, type IIB; activin receptor IIB; Activin receptor type IIB; Activin receptor type-2B; Activine receptor 2b (transmembrane serine kinase); ACTR-IIB; ActRIIB type II activin receptor B; MGC116908; probable match to ACTIVIN RECEPTOR TYPE IIB PRECURSOR (ACTR-IIB)

          View more View less

          Gene Aliases: ActR-IIB; ACTRIIB; ACVR2B; HTX4

          View more View less

          UniProt ID: (Human) Q13705, (Rat) P38445

          View more View less

          Entrez Gene ID: (Human) 93, (Rat) 25366

          View more View less

          Function(s)
          nucleotide binding protein kinase activity protein serine/threonine kinase activity transmembrane receptor protein serine/threonine kinase activity protein serine/threonine/tyrosine kinase activity protein binding ATP binding kinase activity activin receptor activity, type II transferase activity activin-activated receptor activity kinase activator activity growth factor binding metal ion binding activin binding receptor signaling protein serine/threonine kinase activity transforming growth factor beta-activated receptor activity inhibin binding transforming growth factor beta binding serine/threonine protein kinase receptor
          Process(es)
          negative regulation of transcription from RNA polymerase II promoter skeletal system development gastrulation with mouth forming second kidney development lymphangiogenesis blood vessel remodeling regulation of transcription, DNA-templated cellular iron ion homeostasis signal transduction transmembrane receptor protein serine/threonine kinase signaling pathway determination of left/right symmetry pattern specification process mesoderm development heart development response to glucose post-embryonic development anterior/posterior pattern specification regulation of signal transduction insulin secretion negative regulation of ossification lung development positive regulation of bone mineralization BMP signaling pathway pancreas development developmental process activin receptor signaling pathway positive regulation of activin receptor signaling pathway organ growth odontogenesis of dentin-containing tooth positive regulation of osteoblast differentiation embryonic foregut morphogenesis skeletal system morphogenesis palate development lymphatic endothelial cell differentiation artery development venous blood vessel development retina vasculature development in camera-type eye trophoblast cell migration cellular response to growth factor stimulus negative regulation of cold-induced thermogenesis negative regulation of adipose tissue development protein phosphorylation sexual reproduction signal transduction by protein phosphorylation activation of protein kinase activity
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Spain flag icon
          Spain

          TEST

          Your items have has been added!


          Host server : magellan-search-blue-67655d8755-vzwvz:80/100.66.79.173:80.
          git-commit: dddaa802cd395f65bf1581942d0e97a089c38f41
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.46.0-Offline