Hamburger Menu Button
Thermo Fisher Scientific Logo
登入
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Tubes
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Clinical Genomics
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO 和 CRO 服務
    • CDMO 服務
    • 臨床試驗 CRO 服務
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • Register for an Account
    • How to Order
    • Instrument Support
    • Technical Support Centers
    • Learning Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • 快速訂購
          • 登入
            登入
            Don't have an account ? Create Account
            • 帳戶
            • 訂單
            • 訂製產品與專案
          • Primary Antibodies ›
          • ALDH1B1 Antibodies

          Invitrogen

          ALDH1B1 Polyclonal Antibody

          View all (10) ALDH1B1 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite ALDH1B1 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (11)
          ALDH1B1 Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.
          ALDH1B1 Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.

          FIGURE: 1 / 11

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          ALDH1B1 Antibody (PA5-95376) in ICC/IF

          Immunocytochemistry analysis of ALDH1B1 using anti-ALDH1B1 antibody (Product # PA5-95376) . ALDH1B1 was detected in an immunocytochemical section of A431 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 5 μg/mL rabbit anti-ALDH1B1 antibody (Product # PA5-95376) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section wa... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          ALDH1B1 Antibody in Immunocytochemistry (ICC/IF)
          ALDH1B1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          ALDH1B1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          ALDH1B1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          ALDH1B1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          ALDH1B1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          ALDH1B1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          ALDH1B1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          ALDH1B1 Antibody in Western Blot (WB)
          ALDH1B1 Antibody in Western Blot (WB)
          ALDH1B1 Antibody in Flow Cytometry (Flow)
          ALDH1B1 Polyclonal Antibody

          Product Details

          PA5-95376

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          2-5 µg/mL
          -

          Immunocytochemistry (ICC/IF)

          5 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Non-human primate, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH1B1 (116-156aa RVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADK W).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          no preservative

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2807179

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human HepG2 whole cell, human K562 whole cell, human A431 whole cell, human A549 whole cell, human U20S whole cell, human Hela whole cell, monkey COS-7 whole cell, rat liver tissue, rat testis tissue, rat RH35 whole cell, mouse brain tissue, mouse liver tissue. IHC: human colon cancer tissue, human colonic adenocarcinoma tissue, human endometrial adenocarcinoma tissue, human hepatocellular carcinoma tissue, human laryngeal squamous cell carcinoma tissue, mouse colon tissue, rat colon tissue. ICC/IF: A431 cell. Flow: HEL cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          Aldehyde dehydrogenases (ALDHs) mediate NADP+-dependent oxidation of aldehydes into acids during detoxification of alcohol-derived acetaldehyde, lipid peroxidation and metabolism of corticosteroids, biogenic amines and neurotransmitters. Alcohol drinking habits and cardiovascular disease risk factors may be associated with ALDH gene variants. ALDH1B1 (Aldehyde dehydrogenase family 1 member B1), also known as ALDH5 or ALDHX (Aldehyde dehydrogenase X, mitochondrial), is a 517 amino acid mitochondrial protein that is expressed in the liver, testis and to a lesser extent in brain. ALDH1B1 belongs to the aldehyde dehydrogenase family and may play a major role in ethanol detoxification.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: acetaldehyde dehydrogenase 5; aldehyde dehydrogenase 1B1; Aldehyde dehydrogenase 5; Aldehyde dehydrogenase family 1 member B1; Aldehyde dehydrogenase X, mitochondrial; ALDH class 2; epididymis secretory sperm binding protein; MGC2230; unnamed protein product

          View more View less

          Gene Aliases: 2700007F14Rik; ALDH1B1; ALDH5; ALDHX

          View more View less

          UniProt ID: (Human) P30837, (Mouse) Q9CZS1, (Rat) Q66HF8

          View more View less

          Entrez Gene ID: (Human) 219, (Mouse) 72535, (Rat) 298079

          View more View less

          Function(s)
          aldehyde dehydrogenase (NAD) activity oxidoreductase activity oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor NAD binding molecular_function dehydrogenase oxidoreductase metabolite interconversion enzyme
          Process(es)
          carbohydrate metabolic process ethanol catabolic process cellular aldehyde metabolic process metabolic process oxidation-reduction process biological_process
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Hong Kong flag icon
          Hong Kong

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-5cvsx:80/100.66.79.163:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline