Applications | Tested Dilution | Publications |
---|---|---|
Western Blot (WB) |
0.1-0.5 µg/mL | - |
Immunohistochemistry (Paraffin) (IHC (P)) |
0.5-1 µg/mL | - |
Product Specifications | |
---|---|
Species Reactivity |
Human, Mouse, Rat |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH2. |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Antigen affinity chromatography |
Storage buffer |
PBS with 5mg BSA |
Contains |
0.05mg sodium azide |
Storage conditions |
-20°C |
RRID |
AB_2745873 |
The synthetic peptide sequence is 18-48aa, SAAATQAVPAPNQQPEVFCNQIFINNEWHDA
Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.
ALDH2 belongs to the aldehyde dehydrogenase family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of this enzyme, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of Asians have only the cytosolic isozyme, missing the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among Asians than among Caucasians could be related to the absence of the mitochondrial isozyme.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: acetaldehyde dehydrogenase 2; AHD-M1; aldehyde dehydrogenase 2, mitochondrial; Aldehyde dehydrogenase, mitochondrial; ALDH class 2; ALDH-E2; ALDH1; ALDHI; EC 1.2.1.3; liver mitochondrial ALDH; MGC1806; mitochondrial aldehyde dehydrogenase; nucleus-encoded mitochondrial aldehyde dehydrogenase 2
Gene Aliases: Ahd-1; Ahd-5; AHD-M1; Ahd1; Ahd5; ALDH-E2; ALDH2; ALDHI; ALDM
UniProt ID: (Human) P05091, (Rat) P11884, (Mouse) P47738
Entrez Gene ID: (Human) 217, (Rat) 29539, (Mouse) 11669
Molecular Function:
dehydrogenase
oxidoreductase
metabolite interconversion enzyme
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support