Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Cell Analysis
    • Antibodies
    • Mass Spectrometry
    • Cell Culture
    • Laboratory Instruments
    • Clinical and Diagnostics
    • Chromatography
    • Laboratory Equipment
    • Laboratory Supplies
    • Molecular Biology and Nucleic Acid Analysis
    • Sequence-Specific Nucleic Acid Products
    • See all product categories
  • Applications
    • Cell Culture and Transfection
    • Flow Cytometry
    • Cancer Research
    • Chromatography
    • Sequencing
    • PCR
    • Lab Solutions
    • Allergy Diagnostics
    • See all applications and techniques
  • Services
    • Instrument Services
    • Cell Biology Services
    • Custom Services
    • Training Services
    • Lab Informatics Services
    • Financial and Leasing Services
    • Partnering and Licensing Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • See all services
  • Help and Support
    • How to Order
    • Promotions and Online Offers
    • Contact Us
    • Change Location
    • Create a New Account
    • See all help and support topics
  • Popular
    • Our Instagram
      Our Instagram
    • Our Facebook
      Our Facebook
    • Blog Behind the Bench
      Blog Behind the Bench
    • Customer Experience Center (CEC)
      Customer Experience Center (CEC)
    • Ecommerce Exclusives
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Special Offers
  • Contact Us
  • Quick Order
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Contact Us
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Custom Products & Projects
          • Primary Antibodies ›
          • ALOX12 Antibodies

          Invitrogen

          ALOX12 Polyclonal Antibody

          1 Published Figure
          1 Reference
          View all (13) ALOX12 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite ALOX12 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (1)
          • Published Figures (1)
          ALOX12 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.
          ALOX12 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.

          FIGURE: 1 / 2

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          ALOX12 Antibody (PA5-78760) in WB

          Western blot analysis of 12 Lipoxygenase in, Lane 1: rat spleen tissue lysates, Lane 2: mouse spleen tissue lysates. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50 µg of sample under reducing conditions. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. The membrane was blocked with 5% Non-fat Milk/ TBS for 1. 5 hour at RT. The membrane was incubated with ALOX12 Polyclonal... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          ALOX12 Antibody in Western Blot (WB)
          ALOX12 Antibody in Western Blot (WB)
          ALOX12 Polyclonal Antibody

          Product Details

          PA5-78760

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          View 1 publication 1 publication
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Published species

          Mouse

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the N-terminus of human 12 Lipoxygenase (186-231aa ALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQ).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          no preservative

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2745876

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: rat spleen tissue, mouse spleen tissue.

          Target Information

          The ALOX12 gene encodes the enzyme arachidonate 12-lipoxygenase, a member of the lipoxygenase family that metabolizes arachidonic acid into bioactive lipid mediators. ALOX12 catalyzes the formation of 12-hydroperoxyeicosatetraenoic acid (12-HPETE), which is further reduced to 12-hydroxyeicosatetraenoic acid (12-HETE). These products are involved in various biological processes, including inflammation, cellular signaling, and blood platelet function. ALOX12 plays a significant role in pathophysiological conditions such as cancer, cardiovascular diseases, and inflammatory disorders. Dysregulation or altered expression of ALOX12 has been implicated in tumorigenesis and metastasis, where its metabolites influence cell proliferation, migration, and survival. Additionally, ALOX12 impacts platelet aggregation and inflammation, making it a potential target for therapeutic strategies aimed at treating diseases linked to lipid mediator imbalances. Research into ALOX12 continues to explore its functions in health and disease, emphasizing its importance in lipid metabolism and signaling pathways.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          Bioinformatics

          Protein Aliases: 12LOX; 12S LOX; 12S-lipoxygenase; 12S-LOX; Arachidonate (12S)-lipoxygenase; Arachidonate (15S)-lipoxygenase; Arachidonate 12-lipoxygenase, 12S-type; arachidonate 15-lipoxygenase,15S-type; Linoleate (13S)-lipoxygenase; linoleate 13S-lipoxygenase; Lipoxin synthase 12-LO; P-12LO; platelet 12-LOX; platelet-type 12-lipoxygenase; platelet-type 12-lipoxygenase/arachidonate 12-lipoxygenase; Platelet-type lipoxygenase 12; Polyunsaturated fatty acid lipoxygenase ALOX12

          View more View less

          Gene Aliases: 12-LO; 12-LOX; 12LO; 12S-LOX; 9930022G08Rik; ALOX12; Alox12p; LOG12; P-12LO

          View more View less

          UniProt ID: (Human) P18054, (Rat) F1LQ70, (Mouse) P39655

          View more View less

          Entrez Gene ID: (Human) 239, (Rat) 287454, (Mouse) 11684

          View more View less

          Function(s)
          arachidonate 12-lipoxygenase activity iron ion binding protein binding linoleate 13S-lipoxygenase activity oxidoreductase activity oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen hydrolase activity metal ion binding hepoxilin-epoxide hydrolase activity arachidonate 15-lipoxygenase activity dioxygenase activity juvenile hormone epoxide hydrolase activity epoxide hydrolase B activity phenanthrene-9,10-epoxide hydrolase (9R,10R-forming) activity epoxide hydrolase A activity phenanthrene-3,4-epoxide hydrolase activity phenanthrene-1,2-epoxide hydrolase activity phenanthrene-9,10-epoxide hydrolase (9S,10S-forming) activity phenanthrene-epoxide hydrolase activity phenanthrene-9,10-epoxide hydrolase activity pyrene-4,5-epoxide hydrolase activity oxygenase
          Process(es)
          lipid metabolic process fatty acid metabolic process negative regulation of muscle cell apoptotic process arachidonic acid metabolic process lipoxygenase pathway fatty acid oxidation unsaturated fatty acid metabolic process lipid oxidation superoxide anion generation long-chain fatty acid biosynthetic process linoleic acid metabolic process hepoxilin biosynthetic process establishment of skin barrier negative regulation of platelet aggregation leukotriene A4 metabolic process lipoxin A4 biosynthetic process lipoxin B4 biosynthetic process aging positive regulation of cell proliferation positive regulation of endothelial cell migration positive regulation of gene expression positive regulation of cell death positive regulation of cell growth positive regulation of cell migration positive regulation of apoptotic process negative regulation of apoptotic process positive regulation of cysteine-type endopeptidase activity involved in apoptotic process positive regulation of endothelial cell differentiation positive regulation of angiogenesis positive regulation of cell adhesion positive regulation of vasodilation positive regulation of smooth muscle cell proliferation positive regulation of mitochondrial depolarization oxidation-reduction process cellular response to lipid movement of cell or subcellular component
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Find Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Brasil flag icon
          Brasil

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-8dsbr:80/100.66.76.150:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline