Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
| Applications | Tested Dilution | Publications |
|---|---|---|
Western Blot (WB) |
0.1-0.5 µg/mL | - |
| Product Specifications | |
|---|---|
Species Reactivity |
Human, Rat |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence in the middle region of human AMACR, different from the related mouse and rat sequences by four amino acids. |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Affinity chromatography |
Storage buffer |
PBS with 5mg BSA |
Contains |
0.05mg sodium azide |
Storage conditions |
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
RRID |
AB_2807168 |
Synthetic peptide sequence: 208-246aa, RGQNMLDGGAPFYTTYRTADGEFMAVGAIEPQFYELLIK.
Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
P504S/AMACR/a-Methylacyl-CoA Racemase is an essential enzyme in the b-oxidation of branched-chain fatty acids. High expression of P504S protein is found in prostatic adenocarcinoma but not in benign prostate tissue by immunohistochemical staining in paraffin-embedded tissue. The expression of P504S is also detected in two premalignant lesions of the prostate: high-grade prostatic intraepithelial neoplasia (PIN) and atypical adenomatous hyperplasia.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: 2-arylpropionyl-CoA epimerase; 2-methylacyl-CoA racemase; Alpha-methylacyl-CoA racemase; amcr; OTTHUMP00000219978; OTTHUMP00000219979
Gene Aliases: AMACR; AMACRD; CBAS4; Da1-8; Marc1; RACE; RM
UniProt ID: (Human) Q9UHK6
Entrez Gene ID: (Human) 23600, (Rat) 25284
Molecular Function:
transferase
metabolite interconversion enzyme
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support
