Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
AMHR2 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 7
AMHR2 Antibody (PA5-78769) in ICC/IF
Immunocytochemistry analysis of AMHR2 using anti-AMHR2 antibody (Product # PA5-78769) . AMHR2 was detected in an immunocytochemical section of CACO-2 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 5 μg/mL rabbit anti-AMHR2 antibody (Product # PA5-78769) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was coun... View More
Product Details
PA5-78769
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human AMHR2 (384-419aa QRYMAPELLDKTLDLQDWGMALRRADIYSLALLLWE).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human 293T whole cell, human MCF-7 whole cell, human HL-60 whole cell, human Caco-2 whole cell, human K562 whole cell, human HepG2 whole cell, human PC-3 whole cell, human A549 whole cell. IHC: mouse testis tissue, rat testis tissue, human ovarian cancer tissue, human testis cancer tissue. ICC/IF: CACO-2 cell. Flow: K562 cell.
Target Information
The AMH receptor (AMHR or AMHR2) is a serine/threonine kinase with a single transmembrane domain belonging to the family of type II receptors for TGF-beta-related proteins. Anti-Mullerian hormone (AMH) and its receptor are involved in the regression of Mullerian ducts in male fetuses. Male sex differentiation is mediated by 2 discrete hormones produced by the fetal testis. Testosterone, produced by Leydig cells, virilizes the external genitalia and promotes prostatic growth; anti-Mullerian hormone (AMH) results in regression of Mullerian ducts which would otherwise differentiate into the uterus and fallopian tubes.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: AMH type II receptor; Anti-Muellerian hormone type II receptor; Anti-Muellerian hormone type-2 receptor; anti-Mullerian hormone receptor type 11 SV1; anti-Mullerian hormone receptor type II; anti-Mullerian hormone receptor, type II; anti-Mullerian hormone type 2 receptor; anti-Mullerian hormone type 2 receptor delta 2; anti-Mullerian hormone type 2 receptor delta 9/10; C14; MIS type II receptor; MISRII; MRII; Muellerian inhibiting substance type II receptor; Mullerian inhibiting substance type II receptor
Gene Aliases: AMHR; AMHR2; Misiir; MISR2; MISRII; MRII
UniProt ID: (Human) Q16671, (Mouse) Q8K592, (Rat) Q62893
Entrez Gene ID: (Human) 269, (Mouse) 110542, (Rat) 29530
receptor signaling protein serine/threonine kinase activity
receptor activity
transforming growth factor beta receptor activity, type II
protein binding
ATP binding
hormone binding
metal ion binding
anti-Mullerian hormone receptor activity
nucleotide binding
protein kinase activity
protein serine/threonine kinase activity
transmembrane receptor protein serine/threonine kinase activity
transforming growth factor beta-activated receptor activity
kinase activity
transferase activity
transferase activity, transferring phosphorus-containing groups
serine/threonine protein kinase receptor
Mullerian duct regression
signal transduction
transforming growth factor beta receptor signaling pathway
sex differentiation
male gonad development
female gonad development
signal transduction by protein phosphorylation
negative regulation of anti-Mullerian hormone signaling pathway
anti-Mullerian hormone signaling pathway
protein phosphorylation
transmembrane receptor protein serine/threonine kinase signaling pathway
G-protein coupled receptor signaling pathway
phosphorylation
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support