Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Cell Analysis
    • Antibodies
    • Mass Spectrometry
    • Cell Culture
    • Laboratory Instruments
    • Clinical and Diagnostics
    • Chromatography
    • Laboratory Equipment
    • Laboratory Supplies
    • Molecular Biology and Nucleic Acid Analysis
    • Sequence-Specific Nucleic Acid Products
    • See all product categories
  • Applications
    • Cell Culture and Transfection
    • Flow Cytometry
    • Cancer Research
    • Chromatography
    • Sequencing
    • PCR
    • Lab Solutions
    • Allergy Diagnostics
    • See all applications and techniques
  • Services
    • Cell Biology Services
    • Custom Services
    • Training Services
    • Lab Informatics Services
    • Financial and Leasing Services
    • Partnering and Licensing Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Food Safety Inspection Services
    • See all services
  • Help and Support
    • How to Order
    • Promotions and Online Offers
    • Contact Us
    • Change Location
    • Create a New Account
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Special Offers
  • Contact Us
  • Quick Order
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Contact Us
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Custom Products & Projects
          • Primary Antibodies ›
          • AMHR2 Antibodies

          Invitrogen

          AMHR2 Polyclonal Antibody

          View all (17) AMHR2 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite AMHR2 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (7)
          AMHR2 Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.
          AMHR2 Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.

          FIGURE: 1 / 7

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          AMHR2 Antibody (PA5-78769) in ICC/IF

          Immunocytochemistry analysis of AMHR2 using anti-AMHR2 antibody (Product # PA5-78769) . AMHR2 was detected in an immunocytochemical section of CACO-2 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 5 μg/mL rabbit anti-AMHR2 antibody (Product # PA5-78769) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was coun... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          AMHR2 Antibody in Immunocytochemistry (ICC/IF)
          AMHR2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          AMHR2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          AMHR2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          AMHR2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          AMHR2 Antibody in Western Blot (WB)
          AMHR2 Antibody in Flow Cytometry (Flow)
          AMHR2 Polyclonal Antibody

          Product Details

          PA5-78769

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -

          Immunocytochemistry (ICC/IF)

          5 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human AMHR2 (384-419aa QRYMAPELLDKTLDLQDWGMALRRADIYSLALLLWE).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2745885

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human 293T whole cell, human MCF-7 whole cell, human HL-60 whole cell, human Caco-2 whole cell, human K562 whole cell, human HepG2 whole cell, human PC-3 whole cell, human A549 whole cell. IHC: mouse testis tissue, rat testis tissue, human ovarian cancer tissue, human testis cancer tissue. ICC/IF: CACO-2 cell. Flow: K562 cell.

          Target Information

          The AMH receptor (AMHR or AMHR2) is a serine/threonine kinase with a single transmembrane domain belonging to the family of type II receptors for TGF-beta-related proteins. Anti-Mullerian hormone (AMH) and its receptor are involved in the regression of Mullerian ducts in male fetuses. Male sex differentiation is mediated by 2 discrete hormones produced by the fetal testis. Testosterone, produced by Leydig cells, virilizes the external genitalia and promotes prostatic growth; anti-Mullerian hormone (AMH) results in regression of Mullerian ducts which would otherwise differentiate into the uterus and fallopian tubes.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: AMH type II receptor; Anti-Muellerian hormone type II receptor; Anti-Muellerian hormone type-2 receptor; anti-Mullerian hormone receptor type 11 SV1; anti-Mullerian hormone receptor, type II; anti-Mullerian hormone type 2 receptor; anti-Mullerian hormone type 2 receptor delta 2; anti-Mullerian hormone type 2 receptor delta 9/10; C14; MIS type II receptor; MISRII; MRII; Muellerian inhibiting substance type II receptor; Mullerian inhibiting substance type II receptor; serine/threonine single transmembrane kinase receptor

          View more View less

          Gene Aliases: AMHR; AMHR2; Misiir; MISR2; MISRII; MRII

          View more View less

          UniProt ID: (Human) Q16671, (Mouse) Q8K592, (Rat) Q62893

          View more View less

          Entrez Gene ID: (Human) 269, (Mouse) 110542, (Rat) 29530

          View more View less

          Function(s)
          nucleotide binding protein kinase activity protein serine/threonine kinase activity transmembrane receptor protein serine/threonine kinase activity transforming growth factor beta-activated receptor activity transforming growth factor beta receptor activity, type II protein binding ATP binding kinase activity transferase activity hormone binding protein homodimerization activity metal ion binding anti-Mullerian hormone receptor activity receptor signaling protein serine/threonine kinase activity receptor activity transferase activity, transferring phosphorus-containing groups serine/threonine protein kinase receptor
          Process(es)
          Mullerian duct regression transmembrane receptor protein serine/threonine kinase signaling pathway transforming growth factor beta receptor signaling pathway sex differentiation male gonad development female gonad development BMP signaling pathway cellular response to growth factor stimulus anti-Mullerian hormone signaling pathway protein phosphorylation signal transduction G-protein coupled receptor signaling pathway phosphorylation negative regulation of anti-Mullerian hormone signaling pathway signal transduction by protein phosphorylation
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          • Social Media
          • Contact Us
          • Report a Site Issue
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Argentina flag icon
          Argentina

          Your items have has been added!


          Host server : magellan-search-blue-744bc48644-5wn4c:80/100.66.76.150:80.
          git-commit: 747bde55a712f6f97bf7760408d445eefba4e16f
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.48.0-Offline