Search Thermo Fisher Scientific
Search Thermo Fisher Scientific
Synthetic peptide sequence: 122-151aa, PINATSKDDSDVTEVMWQPALRRGRGLQAQ.
Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
Members in the TNF superfamily regulate immune responses and induce apoptosis. A novel member in the TNF family was recently identified by several groups and designated APRIL (for A PRoliferation-Inducing Ligand), TALL2 (for TNF and ApoL-related Leukocyte-expressed Ligand 2), and TRDL 1a (for TNF related death ligand 1a) in human and mouse. Two receptors for APRIL were recently identified and designated TACI and BCMA. APRIL stimulates B and T cell proliferation, triggers humoral immune responses, activates NF-kB, and induces cell death. APRIL and its close relative of BlyS and their receptors BCMA and TACI are involved in diseases of autoimmunity and cancer.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support