Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
FIGURE: 1 / 1
ASL Antibody (PA5-78826) in WB
Western blot analysis of Argininosuccinate Lyase/ASL in, Lane 1: rat liver tissue lysates, Lane 2: rat kidney tissue lysates, Lane 3: rat lung tissue lysates, Lane 4: mouse liver tissue lysates. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50 µg of sample under reducing conditions. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. The membrane was blocked with 5% Non-fat Mi... View More
Product Details
PA5-78826
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence of human Argininosuccinate Lyase/ASL (YTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRIN).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Wet ice
RRID
AB_2745942
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
ASL encodes a member of the lyase 1 family. The encoded protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in this gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency. A nontranscribed pseudogene is also located on the long arm of chromosome 22. Alternatively spliced transcript variants encoding different isoforms have been described.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: argininosuccinase; Argininosuccinate lyase; Arginosuccinase; ASAL
Gene Aliases: 2510006M18Rik; ASAL; ASL
UniProt ID: (Human) P04424, (Mouse) Q91YI0, (Rat) P20673
Entrez Gene ID: (Human) 435, (Mouse) 109900, (Rat) 59085
urea cycle
internal protein amino acid acetylation
arginine biosynthetic process
arginine catabolic process
arginine biosynthetic process via ornithine
protein tetramerization
argininosuccinate metabolic process
liver development
cellular amino acid metabolic process
locomotory behavior
cellular amino acid biosynthetic process
post-embryonic development
ammonia assimilation cycle
kidney development
midgut development
aging
response to nutrient
response to toxic substance
response to zinc ion
response to amine
response to lipopolysaccharide
response to drug
response to peptide hormone
response to steroid hormone
response to growth hormone
diaphragm development
cellular response to ammonium ion
cellular response to cAMP
cellular response to interferon-gamma
cellular response to tumor necrosis factor
cellular response to glucagon stimulus
cellular response to glucocorticoid stimulus
cellular response to hypoxia
cellular response to dexamethasone stimulus
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support