Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
FIGURE: 1 / 3
ASXL1 Antibody (PA5-78828) in WB
Western blot analysis of ASXL1 in Lane 1: human HeLa whole cell lysate, Lane 2: human COLO-320 whole cell lysate, Lane 3: human 293T whole cell lysate, Lane 4: human Jurkat whole cell lysate, Lane 5: mouse testis tissue lysate using 50 µg (reducing conditions) per well. Electrophoresis was performed on 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours and protein was transferred to a nitrocellulose membrane at 150mA for 50-90 minutes. Sample was blocked with 5% Non-fat Milk/TBS for 1.5 hours at room temperature, ... View More
Product Details
PA5-78828
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence of human ASXL1 (KKERTWAEAARLVLENYSDAPMTPKQILQVIEAE).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Wet ice
RRID
AB_2745944
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Probable Polycomb group (PcG) protein involved in transcriptional regulation mediated by ligand-bound nuclear hormone receptors, such as retinoic acid receptors (RARs) and peroxisome proliferator-activated receptor gamma (PPARG). Acts as coactivator of RARA and RXRA through association with NCOA1. Acts as corepressor through recruitment of KDM1A and CBX5 to target genes in a cell-type specific manner; the function seems to involve differential recruitment of methylated histone H3 to respective promoters. Acts as corepressor for PPARG and suppresses its adipocyte differentiation-inducing activity. Non-catalytic component of the PR-DUB complex, a complex that specifically mediates deubiquitination of histone H2A monoubiquitinated at 'Lys-119' (H2AK119ub1).
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: additional sex combs like 1; additional sex combs like transcriptional regulator 1; Additional sex combs-like protein 1; MGC117280; MGC71111; Polycomb group protein ASXL1; putative Polycomb group protein ASXL1
Gene Aliases: ASXL1; BOPS; KIAA0978; MDS; mKIAA0978; RGD1561878
UniProt ID: (Human) Q8IXJ9, (Mouse) P59598
Entrez Gene ID: (Human) 171023, (Mouse) 228790, (Rat) 311553
negative regulation of transcription from RNA polymerase II promoter
heart morphogenesis
transcription, DNA-templated
response to retinoic acid
negative regulation of peroxisome proliferator activated receptor signaling pathway
monoubiquitinated histone H2A deubiquitination
negative regulation of fat cell differentiation
positive regulation of transcription from RNA polymerase II promoter
positive regulation of retinoic acid receptor signaling pathway
negative regulation of retinoic acid receptor signaling pathway
bone development
lung saccule development
regulation of transcription, DNA-templated
chromatin modification
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support