Search

  • 訂單查詢
  • 快速訂購

Invitrogen

ATF4 Polyclonal Antibody

View all (53) ATF4 antibodies

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Certificates
Protocols
Questions & Answers
Tech Support
Datasheet
Certificates
Protocols
Questions & Answers
Tech Support
Datasheet
Certificates
Protocols
Questions & Answers
Tech Support
Additional Information:
{{banner.description}}
{{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
ATF4 Polyclonal Antibody

Product Details

PA5-78832

Applications
Tested Dilution
Publications

Western Blot (WB)

0.1-0.5 µg/mL
-

Immunohistochemistry (Paraffin) (IHC (P))

0.5-1 µg/mL
-
Product Specifications

Species Reactivity

Human

Host/Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence of human ATF4 (KELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP).
View immunogen

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Lyophilized

Concentration

500 µg/mL

Purification

Antigen affinity chromatography

Storage buffer

PBS with 4mg trehalose

Contains

0.05mg sodium azide

Storage conditions

-20°C

Shipping conditions

Ambient (domestic); Wet ice (international)

RRID

AB_2745948

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Positive Control - WB: human SW620 whole cell, human Hela whole cell. IHC: human ovary cancer tissue, human prostatic cancer tissue.

Target Information

This gene encodes a transcription factor that was originally identified as a widely expressed mammalian DNA binding protein that could bind a tax-responsive enhancer element in the LTR of HTLV-1. The encoded protein was also isolated and characterized as the cAMP-response element binding protein 2 (CREB-2). The protein encoded by this gene belongs to a family of DNA-binding proteins that includes the AP-1 family of transcription factors, cAMP-response element binding proteins (CREBs) and CREB-like proteins. These transcription factors share a leucine zipper region that is involved in protein-protein interactions, located C-terminal to a stretch of basic amino acids that functions as a DNA binding domain. Two alternative transcripts encoding the same protein have been described. Two pseudogenes are located on the X chromsome at q28 in a region containing a large inverted duplication.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: Activating transcription factor 4; ATF 4; ATF4; ATF4 protein; cAMP response element-binding protein 2; cAMP-dependent transcription factor ATF-4; cAMP-responsive element-binding protein 2; CREB 2; CREB-2; Cyclic AMP-dependent transcription factor ATF-4; Cyclic AMP-responsive element-binding protein 2; DNA-binding protein TAXREB67; OTTHUMP00000199130; tax-re; tax-responsive enhancer element B67; Tax-responsive enhancer element-binding protein 67; TaxREB67; unnamed protein product

View more View less

Gene Aliases: ATF4; CREB-2; CREB2; TAXREB67; TXREB

View more View less

UniProt ID: (Human) P18848

View more View less

Entrez Gene ID: (Human) 468

View more View less

Function(s)
transcription regulatory region sequence-specific DNA binding RNA polymerase II regulatory region sequence-specific DNA binding RNA polymerase II core promoter proximal region sequence-specific DNA binding RNA polymerase II transcription factor activity, sequence-specific DNA binding transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding DNA binding transcription factor activity, sequence-specific DNA binding protein binding cAMP response element binding protein binding protein kinase binding identical protein binding leucine zipper domain binding sequence-specific DNA binding protein heterodimerization activity RNA polymerase II sequence-specific DNA binding transcription factor binding general transcription initiation factor binding DNA-binding transcription factor binding sequence-specific double-stranded DNA binding promoter-specific chromatin binding
Process(es)
negative regulation of transcription from RNA polymerase II promoter gluconeogenesis regulation of transcription, DNA-templated regulation of transcription from RNA polymerase II promoter transcription from RNA polymerase II promoter cellular calcium ion homeostasis gamma-aminobutyric acid signaling pathway circadian rhythm response to toxic substance positive regulation of vascular endothelial growth factor production positive regulation of gene expression neuron differentiation bone mineralization endoplasmic reticulum unfolded protein response response to nutrient levels negative regulation of translational initiation in response to stress circadian regulation of gene expression cellular response to amino acid starvation cellular response to oxidative stress cellular response to UV response to endoplasmic reticulum stress embryonic hemopoiesis PERK-mediated unfolded protein response cellular response to glucose starvation mRNA transcription from RNA polymerase II promoter regulation of apoptotic process positive regulation of apoptotic process negative regulation of potassium ion transport positive regulation of neuron apoptotic process regulation of osteoblast differentiation positive regulation of transcription, DNA-templated positive regulation of transcription from RNA polymerase I promoter positive regulation of transcription from RNA polymerase II promoter regulation of synaptic plasticity rhythmic process intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress positive regulation of biomineral tissue development lens fiber cell morphogenesis L-asparagine metabolic process cellular response to hypoxia mitochondrial respiratory chain supercomplex assembly negative regulation of cold-induced thermogenesis integrated stress response signaling HRI-mediated signaling GDF15-GFRAL signaling pathway negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway positive regulation of vascular associated smooth muscle cell apoptotic process cellular response to leucine starvation response to manganese-induced endoplasmic reticulum stress positive regulation of sodium-dependent phosphate transport
guarantee_icon

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support