Hamburger Menu Button
Thermo Fisher Scientific Logo
登入
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Tubes
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Clinical Genomics
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO 和 CRO 服務
    • CDMO 服務
    • 臨床試驗 CRO 服務
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • Register for an Account
    • How to Order
    • Instrument Support
    • Technical Support Centers
    • Learning Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • 快速訂購
          • 登入
            登入
            Don't have an account ? Create Account
            • 帳戶
            • 訂單
            • 訂製產品與專案
          • Primary Antibodies ›
          • ATG14 Antibodies

          Invitrogen

          ATG14 Polyclonal Antibody

          1 Reference
          View all (13) ATG14 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite ATG14 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (10)
          ATG14 Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.
          ATG14 Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.

          FIGURE: 1 / 10

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          ATG14 Antibody (PA5-78833) in ICC/IF

          Immunocytochemistry/Immunofluorescence analysis of ATG14 in U2OS cells using ATG14 Polyclonal Antibody (Product # PA5-78833). Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and incubated with the primary antibody at 5 µg/mL. Cy3 conjugated goat anti-rabbit IgG was used as secondary antibody at 1:500 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets approp... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          ATG14 Antibody in Immunocytochemistry (ICC/IF)
          ATG14 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          ATG14 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          ATG14 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          ATG14 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          ATG14 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          ATG14 Antibody in Western Blot (WB)
          ATG14 Antibody in Flow Cytometry (Flow)
          ATG14 Antibody in Flow Cytometry (Flow)
          ATG14 Antibody in Flow Cytometry (Flow)
          ATG14 Polyclonal Antibody

          Product Details

          PA5-78833

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          View 1 publication 1 publication

          Immunocytochemistry (ICC/IF)

          5 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -
          Product Specifications

          Species Reactivity

          Human, Rat

          Published species

          Human

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the N-terminus of human ATG14L (70-101aa RDRERFIDKKERLSRLKSKQEEFQKEVLKAME).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2745949

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: Rat Brain Tissue, HELA whole cell. IHC: Rat Spleen tissue, Human Lung Cancer tissue. ICC/IF: U2OS cell. Flow: SiHa cell, A431 cell, PC-3 cell.

          Target Information

          ATG14 (Autophagy related protein homolog 14) is encoded by the ATG14 gene and is located on chromosome 14 in humans. It is also known as ATG14L or BARKOR (Beclin 1-associated autophagy-related key regulator). Autophagy is an evolutionarily conserved process that involves recycling of misfolded cellular proteins and degradation of dysfunctional organelles. Autophagy is induced as a cellular response to nutrient stress which includes the formation of autophagosomes, fusion of these with the lysosome and formation of the autophagolysosome. The Class III PI3-Kinase, Vps34 and its interacting partner Beclin 1 have been shown to form a complex which specifically includes ATG 14 (type 1) or UVRAG (type 2). Atg 14 guides the type 1 complex to the preautophagosomal structure (PAS) and is critical for the initiation of autophagosome formation.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          Bioinformatics

          Protein Aliases: ATG14 autophagy related 14 homolog; Atg14L; Autophagy-related protein 14-like protein; Bakor; Barkor; Beclin 1-associated autophagy-related key regulator; Beclin 1-Interacting protein; unnamed protein product

          View more View less

          Gene Aliases: ATG14; ATG14L; BARKOR; KIAA0831; RGD1304610

          View more View less

          UniProt ID: (Human) Q6ZNE5, (Rat) D4A4K3

          View more View less

          Entrez Gene ID: (Human) 22863, (Rat) 305831

          View more View less

          Function(s)
          protein binding phosphatidylinositol 3-kinase regulator activity protein anchor GTPase binding phosphatidylinositol 3-kinase inhibitor activity molecular_function
          Process(es)
          autophagosome assembly mitophagy negative regulation of protein phosphorylation positive regulation of protein phosphorylation protein targeting to lysosome autophagy endosome to lysosome transport cellular response to starvation posttranscriptional regulation of gene expression macroautophagy autophagosome membrane docking regulation of macroautophagy phosphatidylinositol-3-phosphate biosynthetic process cellular response to glucose starvation protein kinase B signaling early endosome to late endosome transport innate immune response defense response to virus regulation of protein complex stability regulation of triglyceride metabolic process autophagosome maturation response to mitochondrial depolarisation mitophagy regulation of protein phosphorylation biological_process positive regulation of autophagy
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Hong Kong flag icon
          Hong Kong

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-lnstr:80/100.66.74.145:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline