Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
ATG14 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 10
ATG14 Antibody (PA5-78833) in ICC/IF
Immunocytochemistry/Immunofluorescence analysis of ATG14 in U2OS cells using ATG14 Polyclonal Antibody (Product # PA5-78833). Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and incubated with the primary antibody at 5 µg/mL. Cy3 conjugated goat anti-rabbit IgG was used as secondary antibody at 1:500 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets approp... View More
Product Details
PA5-78833
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Rat
Published species
C. elegans
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human ATG14L (70-101aa RDRERFIDKKERLSRLKSKQEEFQKEVLKAME).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: Rat Brain Tissue, HELA whole cell. IHC: Rat Spleen tissue, Human Lung Cancer tissue. ICC/IF: U2OS cell. Flow: SiHa cell, A431 cell, PC-3 cell.
Target Information
ATG14 (Autophagy related protein homolog 14) is encoded by the ATG14 gene and is located on chromosome 14 in humans. It is also known as ATG14L or BARKOR (Beclin 1-associated autophagy-related key regulator). Autophagy is an evolutionarily conserved process that involves recycling of misfolded cellular proteins and degradation of dysfunctional organelles. Autophagy is induced as a cellular response to nutrient stress which includes the formation of autophagosomes, fusion of these with the lysosome and formation of the autophagolysosome. The Class III PI3-Kinase, Vps34 and its interacting partner Beclin 1 have been shown to form a complex which specifically includes ATG 14 (type 1) or UVRAG (type 2). Atg 14 guides the type 1 complex to the preautophagosomal structure (PAS) and is critical for the initiation of autophagosome formation.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Bioinformatics
Protein Aliases: ATG14 autophagy related 14 homolog; Atg14L; Autophagy-related protein 14-like protein; Bakor; Barkor; Beclin 1-associated autophagy-related key regulator; Beclin 1-Interacting protein
Gene Aliases: ATG14; ATG14L; BARKOR; KIAA0831; RGD1304610
UniProt ID: (Human) Q6ZNE5, (Rat) D4A4K3
Entrez Gene ID: (Human) 22863, (Rat) 305831
autophagosome assembly
regulation of protein phosphorylation
negative regulation of protein phosphorylation
positive regulation of protein phosphorylation
endosome to lysosome transport
cellular response to starvation
positive regulation of autophagy
posttranscriptional regulation of gene expression
macroautophagy
cellular response to glucose starvation
positive regulation of phosphatidylinositol 3-kinase activity
regulation of protein complex stability
regulation of triglyceride metabolic process
mitophagy in response to mitochondrial depolarization
mitophagy
autophagy
biological_process
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support