Sequence of this protein is as follows: AVSRIVEAGCVCNDAVIRNNTLMGKPTEGALIALAMKMGLDGLQQDYIRKAEYPFSSEQKWMAVKCVHRTQQDRPEICFMKGAYEQVIKYCTTYQSKGQTLTLTQQQRDVYQQEKARMGSAGLRVLALASGPELGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSKTSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVA
ATP2C1, also known as secretory pathway Ca2+/Mn2+-ATPase (SPCA) 1, belongs to the family of P-type cation transport ATPases. This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of the calcium from the cytosol to the Golgi lumen. Defects in this gene cause Hailey-Hailey disease, an autosomal dominant disorder characterized by persistent blisters and erosions of the skin. Unlike the related protein ATP2C2, ATP2C1 is ubiquitously expressed and displays a lower maximal turnover rate for overall Ca2+-ATPase reaction and a higher apparent affinity for cytosolic Ca2+ activation of phosphorylation. Recent evidence suggests that ATP2C1 is a key regulator of insulin-like growth factor receptor (IGF1R) processing in tumor progression in basal breast cancers.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: ATP-dependent Ca(2+) pump PMR1; ATPase 2C1; ATPase, Ca(2+)-sequestering; ATPase, Ca++ transporting, type 2C, member 1; ATPase, Ca++-sequestering; calcium-transporting ATPase 2C1; Calcium-transporting ATPase type 2C member 1; HUSSY 28; HUSSY-28; rat; secretory pathway Ca(2+)-ATPase 1; secretory pathway Ca2+/Mn2+ ATPase 1
Gene Aliases: 1700121J11Rik; ATP2C1; ATP2C1A; AW061228; BCPM; D930003G21Rik; HHD; hSPCA1; HUSSY-28; KIAA1347; PMR1; PMR1L; SPCA; SPCA1
UniProt ID: (Human) P98194, (Mouse) Q80XR2
Entrez Gene ID: (Human) 27032, (Rat) 170699, (Mouse) 235574
Molecular Function:
cation transporter
hydrolase
ion channel
transporter
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support