Applications | Tested Dilution | Publications |
---|---|---|
Western Blot (WB) |
0.1-0.5 µg/mL | - |
Immunohistochemistry (Paraffin) (IHC (P)) |
2-5 µg/mL | - |
Immunohistochemistry (Frozen) (IHC (F)) |
2-5 µg/mL | - |
Product Specifications | |
---|---|
Species Reactivity |
Human, Mouse, Rat |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence at the C-terminus of human ATX2. |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Antigen affinity chromatography |
Storage buffer |
PBS with 4mg trehalose |
Contains |
no preservative |
Storage conditions |
-20°C |
RRID |
AB_2745962 |
The synthetic peptide sequence is 1283-1313aa, QSALQPIPVSTTAHFPYMTHPSVQAHHQQQL
Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.
The autosomal dominant cerebellar ataxias (ADCA) are a heterogeneous group of neurodegenerative disorders characterized by progressive degeneration of the cerebellum, brain stem and spinal cord. Clinically, ADCA has been divided into three groups: ADCA types I-III. Defects in this gene are the cause of spinocerebellar ataxia type 2 (SCA2). SCA2 belongs to the autosomal dominant cerebellar ataxias type I (ADCA I) which are characterized by cerebellar ataxia in combination with additional clinical features like optic atrophy, ophthalmoplegia, bulbar and extrapyramidal signs, peripheral neuropathy and dementia. SCA2 is caused by expansion of a CAG repeat in the coding region of this gene. Longer expansions result in earlier onset of the disease. Alternatively spliced transcript variants encoding different isoforms have been identified but their full length sequence has not been determined.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: Ataxin-2; FLJ46772; spinocerebellar ataxia 2 (olivopontocerebellar ataxia 2, autosomal dominant, ataxin 2); spinocerebellar ataxia 2 homolog; Spinocerebellar ataxia type 2 protein; Spinocerebellar ataxia type 2 protein homolog; Trinucleotide repeat-containing gene 13 protein
Gene Aliases: 9630045M23Rik; ASL13; ATX2; ATXN2; AW544490; SCA2; TNRC13
UniProt ID: (Human) Q99700, (Mouse) O70305
Entrez Gene ID: (Human) 6311, (Rat) 288663, (Mouse) 20239
Molecular Function:
RNA metabolism protein
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support