Hamburger Menu Button
Thermo Fisher Scientific Logo
登入
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Tubes
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Clinical Genomics
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO 和 CRO 服務
    • CDMO 服務
    • 臨床試驗 CRO 服務
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • Register for an Account
    • How to Order
    • Instrument Support
    • Technical Support Centers
    • Learning Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • 快速訂購
          • 登入
            登入
            Don't have an account ? Create Account
            • 帳戶
            • 訂單
            • 訂製產品與專案
          • Primary Antibodies ›
          • BCAR3 Antibodies

          Invitrogen

          BCAR3 Polyclonal Antibody

          1 Published Figure
          1 Reference
          View all (13) BCAR3 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite BCAR3 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (4)
          • Published Figures (1)
          BCAR3 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          BCAR3 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 5

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          BCAR3 Antibody (PA5-78858) in IHC (P)

          Immunohistochemistry analysis of BCAR3 on paraffin-embedded mouse lymphaden tissue. Sample was incubated with BCAR3 polyclonal antibody (Product# PA5-78858) with a dilution of 1 µg/mL, and developed by Streptavidin-Biotin-Complex (SABC) with DAB chromogen method. {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          BCAR3 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          BCAR3 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          BCAR3 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          BCAR3 Antibody in Western Blot (WB)
          BCAR3 Antibody in Western Blot (WB)
          BCAR3 Polyclonal Antibody

          Product Details

          PA5-78858

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          View 1 publication 1 publication

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Published species

          Mouse

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human BCAR3 (791-825aa KGAQVNQTERYEKFNQILTALSRKLEPPPVKQAEL).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2745974

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: HEPG2 whole cell. IHC: mouse lymphaden tissue, rat spleen tissue, human tonsil tissue.

          Target Information

          Breast tumors are initially dependent on estrogens for growth and progression and can be inhibited by anti-estrogens such as tamoxifen. However, breast cancers progress to become anti-estrogen resistant. Breast cancer anti-estrogen resistance gene 3 was identified in the search for genes involved in the development of estrogen resistance. The gene encodes a component of intracellular signal transduction that causes estrogen-independent proliferation in human breast cancer cells. The protein contains a putative src homology 2 (SH2) domain, a hall mark of cellular tyrosine kinase signaling molecules, and is partly homologous to the cell division cycle protein CDC48.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          Bioinformatics

          Protein Aliases: BCAR3 adapter protein, NSP family member; BCAR3, NSP family adaptor protein; breast cancer anti-estrogen resistance 3; Breast cancer anti-estrogen resistance protein 3; Breast cancer anti-estrogen resistance protein 3 homolog; breast cancer antiestrogen resistance 3 protein; dJ1033H22.2 (breast cancer anti-estrogen resistance 3); epididymis secretory sperm binding protein; KIAA0554; mig-7; migration inducting gene-7; Novel SH2-containing protein 2; OTTHUMP00000011961; p130Cas-binding protein AND-34; SH2 domain-containing protein 3B; unnamed protein product

          View more View less

          Gene Aliases: AI131758; AND-34; And34; BCAR3; MIG7; NSP2; SH2D3B; UNQ271/PRO308

          View more View less

          UniProt ID: (Human) O75815, (Mouse) Q9QZK2, (Rat) D3ZAZ5

          View more View less

          Entrez Gene ID: (Human) 8412, (Mouse) 29815, (Rat) 310838

          View more View less

          Function(s)
          phosphotyrosine binding guanyl-nucleotide exchange factor activity protein binding kinase binding
          Process(es)
          lens morphogenesis in camera-type eye signal transduction small GTPase mediated signal transduction positive regulation of peptidyl-serine phosphorylation positive regulation of GTPase activity epidermal growth factor receptor signaling pathway positive regulation of cell proliferation insulin receptor signaling pathway response to xenobiotic stimulus positive regulation of MAPK cascade endothelin receptor signaling pathway
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Hong Kong flag icon
          Hong Kong

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-hznln:80/100.66.79.29:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline