Hamburger Menu Button
Thermo Fisher Scientific Logo
登入
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Tubes
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Clinical Genomics
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO 和 CRO 服務
    • CDMO 服務
    • 臨床試驗 CRO 服務
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • Register for an Account
    • How to Order
    • Instrument Support
    • Technical Support Centers
    • Learning Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • 快速訂購
          • 登入
            登入
            Don't have an account ? Create Account
            • 帳戶
            • 訂單
            • 訂製產品與專案

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • BMP-2 Antibodies

          Invitrogen

          BMP-2 Polyclonal Antibody

          1 Reference
          View all (32) BMP-2 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Protocols
          Questions & Answers
          Tech Support

          Cite BMP-2 Polyclonal Antibody

          • Antibody Testing Data (3)
          BMP-2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          BMP-2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 3

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          BMP-2 Antibody (PA5-78874) in IHC (P)

          Immunohistochemistry analysis of BMP-2 on paraffin-embedded human intestinal cancer tissue. Sample was incubated with BMP-2 polyclonal antibody (Product# PA5-78874). {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          BMP-2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          BMP-2 Antibody in Western Blot (WB)
          BMP-2 Antibody in ELISA (ELISA)
          BMP-2 Polyclonal Antibody

          Product Details

          PA5-78874

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (IHC)

          -
          View 1 publication 1 publication

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -

          ELISA (ELISA)

          1-5 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Rat

          Published species

          Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-2 (283-312aa QAKHKQRKRLKSSCKRHPLYVDFSDVGWND).
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2745990

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: Rat Lung Tissue, Rat Brain Tissue, U87 whole cell, HELA whole cell. IHC: human intestinal cancer tissue.

          Target Information

          Bone Morphogenic Proteins (BMP) are members of the TGF-beta superfamily that affect bone and cartilage formation (Hogan 1996, Reddi 1998 and Francis-West et al. 1999). Mature BMPs are 30-38 kDa proteins that assume a TGF-beta -like cysteine knot configuration. Lovostatin increases bone formation by turning on the bmp-2 gene (Mundy et al. 1999). BMPs stimulate the production of specific bone matrix proteins and alter stromal cell and osteoclast proliferation (Macias et al. 1999, Lecanda et al. 1997). BMPs may also be an important factor for development of the viscera, with roles in cell proliferation, apoptosis, differentiation, and morphogenesis (Hogan 1996, Dale and Wardle 1999). BMPs appear to be responsible for normal dorsal/ventral patterning. Like TGF-beta, BMPs bind to a type II receptor, which then recruits the transducing type I receptor unit, activating the Smad protein signaling pathway (Massague 1994, Derynck 1997, Attisano 1993).

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          Bioinformatics

          Protein Aliases: 2610024H22Rik; AL117858; AW546137; BB189135; BMP; BMP-2; BMP-2A; BMPR-II; BMPRII; Bone morphogenetic; Bone morphogenetic protein; Bone morphogenetic protein 2; Bone morphogenetic protein 2A; H-BMP-2

          View more View less

          Gene Aliases: BDA2; Bmp-2; BMP2; BMP2A

          View more View less

          UniProt ID: (Human) P12643, (Rat) P49001

          View more View less

          Entrez Gene ID: (Human) 650, (Rat) 29373

          View more View less

          Function(s)
          retinol dehydrogenase activity receptor binding cytokine activity transforming growth factor beta receptor binding protein binding growth factor activity phosphatase activator activity co-receptor binding SMAD binding protein heterodimerization activity BMP receptor binding protein domain specific binding protein homodimerization activity growth factor
          Process(es)
          negative regulation of transcription from RNA polymerase II promoter activation of MAPK activity skeletal system development osteoblast differentiation branching involved in ureteric bud morphogenesis response to hypoxia in utero embryonic development epithelial to mesenchymal transition positive regulation of protein phosphorylation positive regulation of endothelial cell proliferation chondrocyte differentiation BMP signaling pathway involved in heart induction atrioventricular valve morphogenesis endocardial cushion morphogenesis negative regulation of Wnt signaling pathway involved in heart development proteoglycan metabolic process regulation of transcription, DNA-templated protein phosphorylation inflammatory response Notch signaling pathway cell-cell signaling heart development negative regulation of cell proliferation embryo development organ morphogenesis positive regulation of gene expression positive regulation of epithelial to mesenchymal transition positive regulation of pathway-restricted SMAD protein phosphorylation negative regulation of steroid biosynthetic process positive regulation of phosphatase activity telencephalon development telencephalon regionalization positive regulation of Wnt signaling pathway bone mineralization positive regulation of cell migration positive regulation of bone mineralization BMP signaling pathway protein destabilization positive regulation of protein binding negative regulation of aldosterone biosynthetic process positive regulation of osteoblast proliferation cardiocyte differentiation embryonic heart tube anterior/posterior pattern specification bone mineralization involved in bone maturation growth odontogenesis of dentin-containing tooth positive regulation of odontogenesis regulation of odontogenesis of dentin-containing tooth positive regulation of apoptotic process positive regulation of MAPK cascade negative regulation of insulin-like growth factor receptor signaling pathway cell fate commitment positive regulation of fat cell differentiation positive regulation of neuron differentiation positive regulation of osteoblast differentiation positive regulation of ossification negative regulation of cell cycle negative regulation of transcription, DNA-templated positive regulation of transcription, DNA-templated positive regulation of transcription from RNA polymerase II promoter positive regulation of astrocyte differentiation mesenchymal cell differentiation inner ear development negative regulation of calcium-independent cell-cell adhesion cardiac muscle cell differentiation cardiac muscle tissue morphogenesis oxidation-reduction process pericardium development corticotropin hormone secreting cell differentiation thyroid-stimulating hormone-secreting cell differentiation cardiac epithelial to mesenchymal transition pathway-restricted SMAD protein phosphorylation SMAD protein signal transduction mesenchyme development positive regulation of Wnt signaling pathway by BMP signaling pathway positive regulation of cartilage development positive regulation of ERK1 and ERK2 cascade cellular response to organic cyclic compound cellular response to BMP stimulus mesenchymal cell proliferation involved in ureteric bud development negative regulation of canonical Wnt signaling pathway positive regulation of p38MAPK cascade positive regulation of transcription from RNA polymerase II promoter involved in cellular response to chemical stimulus negative regulation of cortisol biosynthetic process negative regulation of cardiac muscle cell differentiation ossification response to mechanical stimulus negative regulation of gene expression response to retinoic acid ovulation cycle regulation of apoptotic process regulation of MAPK cascade positive regulation of cell differentiation positive regulation of neurogenesis cartilage development cellular response to mechanical stimulus cellular response to growth factor stimulus
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Hong Kong flag icon
          Hong Kong

          Your items have has been added!


          Host server : magellan-search-green-55658555d6-w54c7:80/100.66.75.127:80.
          git-commit: ec8e7df5f8fec8d765bd419205f1b5046a016d37
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.41.0-Offline