Hamburger Menu Button
Thermo Fisher Scientific Logo
로그인
회원이 아니신가요? 계정 생성하기
  • 모든 제품 주문
    • 항체
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR 분석
    • 피펫 및 피펫 팁
    • 실험실용 원심분리기
    • 초저온 냉동고
    • 분광학
    • 비이커
    • PCR 장비 및 용품
    • 제품 카테고리 전체보기
  • 응용 분야 및 기법
    • 세포 분석
    • 실험실 장비
    • Real-Time PCR
    • PCR
    • 크로마토그래피
    • 세포 배양 및 트랜스펙션
    • DNA/RNA 추출과 분석
    • 단백질 생물학
    • 유세포분석
    • 화학 제품
    • 응용 분야 및 기법 전체보기
  • 서비스
    • 맞춤형 서비스
    • 엔터프라이즈급 실험실 정보 처리
    • 360° CDMO 및 CRO 서비스
    • CDMO 서비스
    • 임상시험 CRO 서비스
    • 장비 서비스
    • 교육 서비스
    • Unity Lab Services
    • 서비스 전체 보기
  • 지원
    • 고객센터
    • 문의하기
    • 시험성적서(COA) 및 적합성 인증서(COC)
    • Safety Data Sheets (SDS)
    • 매뉴얼
    • 인용 및 참고 문헌
    • 기기 지원
    • 기술 자료/제품 FAQ
    • 학습 센터
    • 지원 메뉴 전체보기
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • 문의하기
  • 빠른 주문
  • 주문 현황
  • 제품 문서 검색
Thermo Fisher Scientific Logo

Search

전체검색
Search button
          • 주문 현황
          • 빠른주문
          • 로그인
            로그인
            회원이 아니신가요? 계정 생성하기
            • 계정정보
            • 주문내역조회
            • 커스텀제품 및 프로젝트
            • Services Central
          • Primary Antibodies ›
          • BMP-2 Antibodies

          Invitrogen

          BMP-2 Polyclonal Antibody

          1 Reference
          View all (44) BMP-2 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite BMP-2 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (3)
          BMP-2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          BMP-2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 3

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          BMP-2 Antibody (PA5-78874) in IHC (P)

          Immunohistochemistry analysis of BMP-2 on paraffin-embedded human intestinal cancer tissue. Sample was incubated with BMP-2 polyclonal antibody (Product# PA5-78874). {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          BMP-2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          BMP-2 Antibody in Western Blot (WB)
          BMP-2 Antibody in ELISA (ELISA)
          BMP-2 Polyclonal Antibody

          Product Details

          PA5-78874

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (IHC)

          -
          View 1 publication 1 publication

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -

          ELISA (ELISA)

          1-5 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Rat

          Published species

          Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-2 (283-312aa QAKHKQRKRLKSSCKRHPLYVDFSDVGWND).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2745990

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: Rat Lung Tissue, Rat Brain Tissue, U87 whole cell, HELA whole cell. IHC: human intestinal cancer tissue.

          Target Information

          Bone Morphogenic Proteins (BMP) are members of the TGF-beta superfamily that affect bone and cartilage formation (Hogan 1996, Reddi 1998 and Francis-West et al. 1999). Mature BMPs are 30-38 kDa proteins that assume a TGF-beta -like cysteine knot configuration. Lovostatin increases bone formation by turning on the bmp-2 gene (Mundy et al. 1999). BMPs stimulate the production of specific bone matrix proteins and alter stromal cell and osteoclast proliferation (Macias et al. 1999, Lecanda et al. 1997). BMPs may also be an important factor for development of the viscera, with roles in cell proliferation, apoptosis, differentiation, and morphogenesis (Hogan 1996, Dale and Wardle 1999). BMPs appear to be responsible for normal dorsal/ventral patterning. Like TGF-beta, BMPs bind to a type II receptor, which then recruits the transducing type I receptor unit, activating the Smad protein signaling pathway (Massague 1994, Derynck 1997, Attisano 1993).

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          Bioinformatics

          Protein Aliases: 2610024H22Rik; AL117858; AW546137; BB189135; BMP; BMP-2; BMP-2A; BMPR-II; BMPRII; Bone morphogenetic; Bone morphogenetic protein; Bone morphogenetic protein 2; Bone morphogenetic protein 2A; H-BMP-2; osteogenic protein 2

          View more View less

          Gene Aliases: BDA2; Bmp-2; BMP2; BMP2A; SSFSC; SSFSC1

          View more View less

          UniProt ID: (Human) P12643, (Rat) P49001

          View more View less

          Entrez Gene ID: (Human) 650, (Rat) 29373

          View more View less

          Function(s)
          receptor binding cytokine activity protein binding growth factor activity phosphatase activator activity co-receptor binding protein serine/threonine kinase activator activity receptor agonist activity BMP receptor binding retinol dehydrogenase activity transforming growth factor beta receptor binding protein domain specific binding protein homodimerization activity SMAD binding protein heterodimerization activity growth factor
          Process(es)
          negative regulation of transcription from RNA polymerase II promoter skeletal system development ossification osteoblast differentiation branching involved in ureteric bud morphogenesis response to hypoxia in utero embryonic development epithelial to mesenchymal transition positive regulation of protein phosphorylation chondrocyte differentiation myeloid leukocyte differentiation heart morphogenesis heart induction endodermal-mesodermal cell signaling aortic valve development atrioventricular valve morphogenesis endocardial cushion morphogenesis cardiac atrium formation endocardial cushion formation positive regulation of extracellular matrix constituent secretion proteoglycan metabolic process regulation of transcription, DNA-templated transcription from RNA polymerase II promoter inflammatory response Notch signaling pathway cell-cell signaling heart development positive regulation of cell proliferation negative regulation of cell proliferation response to bacterium organ morphogenesis gene expression positive regulation of gene expression negative regulation of gene expression positive regulation of epithelial to mesenchymal transition negative regulation of steroid biosynthetic process positive regulation of phosphatase activity telencephalon development telencephalon regionalization negative regulation of cell-cell adhesion cell differentiation positive regulation of Wnt signaling pathway bone mineralization osteoclast differentiation positive regulation of cell migration positive regulation of bone mineralization BMP signaling pathway negative regulation of transforming growth factor beta receptor signaling pathway positive regulation of epithelial cell differentiation protein destabilization negative regulation of aldosterone biosynthetic process positive regulation of osteoblast proliferation cardiocyte differentiation embryonic heart tube anterior/posterior pattern specification positive regulation of peroxisome proliferator activated receptor signaling pathway ameloblast differentiation odontogenesis of dentin-containing tooth positive regulation of odontogenesis regulation of odontogenesis of dentin-containing tooth positive regulation of apoptotic process positive regulation of MAPK cascade negative regulation of insulin-like growth factor receptor signaling pathway cell fate commitment positive regulation of cell differentiation negative regulation of fat cell differentiation positive regulation of fat cell differentiation positive regulation of neuron differentiation positive regulation of osteoblast differentiation positive regulation of ossification negative regulation of cell cycle negative regulation of transcription, DNA-templated positive regulation of transcription, DNA-templated positive regulation of transcription from RNA polymerase II promoter negative regulation of smooth muscle cell proliferation astrocyte differentiation positive regulation of astrocyte differentiation mesenchymal cell differentiation inner ear development negative regulation of calcium-independent cell-cell adhesion negative regulation of muscle cell differentiation cartilage development cardiac muscle cell differentiation cardiac muscle tissue morphogenesis pericardium development corticotropin hormone secreting cell differentiation thyroid-stimulating hormone-secreting cell differentiation cardiac epithelial to mesenchymal transition bone development positive regulation of SMAD protein import into nucleus lung vasculature development mesenchyme development muscle tissue development positive regulation of cartilage development positive regulation of ERK1 and ERK2 cascade cellular response to growth factor stimulus cellular response to BMP stimulus mesenchymal cell proliferation involved in ureteric bud development negative regulation of canonical Wnt signaling pathway positive regulation of bone mineralization involved in bone maturation positive regulation of p38MAPK cascade positive regulation of odontoblast differentiation positive regulation of pri-miRNA transcription from RNA polymerase II promoter cardiac jelly development atrioventricular canal morphogenesis negative regulation of cortisol biosynthetic process regulation of cardiac muscle cell differentiation negative regulation of cardiac muscle cell differentiation activation of MAPK activity positive regulation of endothelial cell proliferation BMP signaling pathway involved in heart induction negative regulation of Wnt signaling pathway involved in heart development protein phosphorylation response to mechanical stimulus positive regulation of pathway-restricted SMAD protein phosphorylation response to retinoic acid bone mineralization involved in bone maturation growth ovulation cycle regulation of apoptotic process regulation of MAPK cascade positive regulation of neurogenesis oxidation-reduction process pathway-restricted SMAD protein phosphorylation SMAD protein signal transduction positive regulation of Wnt signaling pathway by BMP signaling pathway cellular response to mechanical stimulus cellular response to organic cyclic compound positive regulation of transcription from RNA polymerase II promoter involved in cellular response to chemical stimulus
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          온라인 주문 Plus Icon Minus Icon
          • 주문 현황
          • 주문 지원
          • 빠른 주문
          • Supply Center
          • eProcurement
          지원 Plus Icon Minus Icon
          • Help and Support
          • 고객 센터
          • 기술 지원 센터
          • 제품 문서 검색
          • 사이트 문제 보고
          교육 및 이벤트 Plus Icon Minus Icon
          • 교육 센터
          • 프로모션
          • 이벤트 및 웨비나
          • 소셜 미디어
          About Thermo Fisher Plus Icon Minus Icon
          • 소개 소개
          • 채용 채용
          • 투자자 투자자
          • 뉴스 뉴스
          • 사회적 책임 사회적 책임
          • Trademarks
          • 공정거래 공정거래
          • 정책 및 고지
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • 이용 약관
          • 개인정보 처리방침
          • 가격 및 운임 정책
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Korea flag icon
          Korea

          고객센터 문의 | 평일 09:00~18:00
          1661-9555   |   Live Chat   |   카카오톡 상담

           

          장비 서비스 문의 | 평일 09:00~18:00
          1661-5055   |   Live Chat

          고객센터 문의 | 평일 09:00~18:00
          1661-9555   |   Live Chat   |   카카오톡 상담

           

          장비 서비스 문의 | 평일 09:00~18:00
          1661-5055   |   Live Chat

          고객센터 문의 | 평일 09:00~18:00
          1661-9555   |   Live Chat   |   카카오톡 상담

           

          장비 서비스 문의 | 평일 09:00~18:00
          1661-5055   |   Live Chat

          써모 피셔 사이언티픽 코리아 주식회사
          대표자 : 석수진
          사업자 등록번호 : 117-81-46910
          입금계좌 : 하나은행 336-890014-06204
          (예금주 : 써모피셔사이언티픽코리아 주식회사)

           

          써모 피셔 사이언티픽 솔루션스 유한회사
          대표자 : 석수진
          사업자 등록번호 : 114-86-04783
          입금계좌 : 신한은행 140-004-396660
          (예금주 : 써모피셔사이언티픽솔루션스 유한회사)

           

          주소 : 서울시 강남구 광평로 281 수서오피스빌딩 12층 06349 | 통신판매업신고번호 : 2015-서울강남-00898

          ISMS Logo

          Your items have has been added!


          Host server : magellan-search-blue-744bc48644-5wn4c:80/100.66.76.150:80.
          git-commit: 747bde55a712f6f97bf7760408d445eefba4e16f
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.48.0-Offline