Applications | Tested Dilution | Publications |
---|---|---|
Western Blot (WB) |
0.1-0.5 µg/mL | - |
Immunohistochemistry (Paraffin) (IHC (P)) |
0.5-1 µg/mL | - |
ELISA (ELISA) |
0.1-0.5 µg/mL | - |
Product Specifications | |
---|---|
Species Reactivity |
Human, Rat |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-2. |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Antigen affinity chromatography |
Storage buffer |
PBS with 5mg BSA |
Contains |
0.05mg sodium azide |
Storage conditions |
-20°C |
RRID |
AB_2745990 |
The synthetic peptide sequence is 283-312aa, QAKHKQRKRLKSSCKRHPLYVDFSDVGWND
Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.
Bone Morphogenic Proteins (BMP) are members of the TGF-beta superfamily that affect bone and cartilage formation (Hogan 1996, Reddi 1998 and Francis-West et al. 1999). Mature BMPs are 30-38 kDa proteins that assume a TGF-beta -like cysteine knot configuration. Lovostatin increases bone formation by turning on the bmp-2 gene (Mundy et al. 1999). BMPs stimulate the production of specific bone matrix proteins and alter stromal cell and osteoclast proliferation (Macias et al. 1999, Lecanda et al. 1997). BMPs may also be an important factor for development of the viscera, with roles in cell proliferation, apoptosis, differentiation, and morphogenesis (Hogan 1996, Dale and Wardle 1999). BMPs appear to be responsible for normal dorsal/ventral patterning. Like TGF-beta, BMPs bind to a type II receptor, which then recruits the transducing type I receptor unit, activating the Smad protein signaling pathway (Massague 1994, Derynck 1997, Attisano 1993).
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: 2610024H22Rik; AL117858; AW546137; BB189135; BMP; BMP-2; BMP-2A; BMPR-II; BMPRII; Bone morphogenetic protein; Bone morphogenetic protein 2; Bone morphogenetic protein 2A; H-BMP-2
Gene Aliases: BDA2; Bmp-2; BMP2; BMP2A
UniProt ID: (Human) P12643, (Rat) P49001
Entrez Gene ID: (Human) 650, (Rat) 29373
Molecular Function:
growth factor
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support