Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Clinical Genomics
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Custom Products & Projects
            • Instrument Management
          • Primary Antibodies ›
          • BMP4 Antibodies

          Invitrogen

          BMP4 Polyclonal Antibody

          View all (21) BMP4 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite BMP4 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (1)
          BMP4 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.
          BMP4 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.

          FIGURE: 1 / 1

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          BMP4 Antibody (PA5-78876) in WB

          Western blot analysis of BMP4 in Lane 1: mouse lung tissue lysate, Lane 2: mouse liver tissue lysate, Lane 3: HEPA whole cell lysate, Lane 4: HEPG2 whole cell lysate, Lane 5: HeLa whole cell lysate using 40-50 µg per well. Sample was incubated with BMP4 (Product # PA5-78876) at a dilution of 0.5 µg/mL. {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          BMP4 Antibody in Western Blot (WB)
          BMP4 Polyclonal Antibody

          Product Details

          PA5-78876

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          ELISA (ELISA)

          0.1-0.5 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-4 (293-324aa SPKHHSQRARKKNKNCRRHSLYVDFSDVGWND).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2745992

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: Mouse Lung Tissue, Mouse Liver Tissue, HEPA whole cell, HEPG2 whole cell, HELA whole cell.

          Target Information

          The protein encoded by this gene is a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. This particular family member plays an important role in the onset of endochondral bone formation in humans, and a reduction in expression has been associated with a variety of bone diseases, including the heritable disorder Fibrodysplasia Ossificans Progressiva. Alternative splicing in the 5' untranslated region of this gene has been described and three variants are described, all encoding an identical protein.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: BMP; BMP-2B; BMP-4; Bone morphogenetic protein; Bone morphogenetic protein 2B; Bone morphogenetic protein 4; unnamed protein product

          View more View less

          Gene Aliases: Bmp-4; BMP2B; Bmp2b-1; BMP2B1; BMP4; Dvr-4; DVR4; MCOPS6; OFC11; ZYME

          View more View less

          UniProt ID: (Human) P12644, (Mouse) P21275

          View more View less

          Entrez Gene ID: (Human) 652, (Mouse) 12159

          View more View less

          Function(s)
          cytokine activity protein binding growth factor activity heparin binding co-receptor binding chemoattractant activity protein serine/threonine kinase activator activity BMP receptor binding transforming growth factor beta receptor binding protein homodimerization activity growth factor
          Process(es)
          negative regulation of transcription from RNA polymerase II promoter skeletal system development ossification angiogenesis blood vessel development osteoblast differentiation metanephros development ureteric bud development branching involved in ureteric bud morphogenesis mesoderm formation organ induction kidney development mesonephros development neural tube closure positive regulation of protein phosphorylation positive regulation of endothelial cell proliferation vasculature development endochondral ossification blood vessel endothelial cell proliferation involved in sprouting angiogenesis chondrocyte differentiation hematopoietic progenitor cell differentiation lymphoid progenitor cell differentiation myeloid leukocyte differentiation heart morphogenesis renal system process heart induction secondary heart field specification outflow tract septum morphogenesis membranous septum morphogenesis muscular septum morphogenesis outflow tract morphogenesis sinoatrial node development aortic valve morphogenesis pulmonary valve morphogenesis endocardial cushion development epithelial to mesenchymal transition involved in endocardial cushion formation cardiac right ventricle morphogenesis apoptotic process involved in endocardial cushion morphogenesis cardiac septum development type B pancreatic cell development transcription from RNA polymerase II promoter germ cell development endoderm development mesoderm development mesodermal cell fate determination heart development cell proliferation positive regulation of cell proliferation negative regulation of cell proliferation post-embryonic development anterior/posterior axis specification specification of organ position regulation of cell fate commitment gene expression regulation of gene expression positive regulation of gene expression negative regulation of gene expression positive regulation of epithelial to mesenchymal transition telencephalon development dorsal/ventral neural tube patterning telencephalon regionalization pituitary gland development negative regulation of cell-cell adhesion cell differentiation erythrocyte differentiation monocyte differentiation macrophage differentiation lung development embryonic limb morphogenesis positive regulation of cell migration positive regulation of bone mineralization BMP signaling pathway regulation of BMP signaling pathway positive regulation of BMP signaling pathway negative regulation of BMP signaling pathway positive regulation of epithelial cell differentiation forebrain development positive regulation of protein binding negative regulation of chondrocyte differentiation positive regulation of collagen biosynthetic process negative regulation of T cell differentiation in thymus negative regulation of immature T cell proliferation in thymus embryonic hindlimb morphogenesis tendon cell differentiation deltoid tuberosity development ameloblast differentiation regulation of protein import into nucleus odontogenesis of dentin-containing tooth odontogenesis regulation of odontogenesis of dentin-containing tooth auditory receptor cell differentiation embryonic digit morphogenesis camera-type eye development positive regulation of apoptotic process positive regulation of programmed cell death cell fate commitment regulation of cell differentiation negative regulation of cell differentiation positive regulation of endothelial cell differentiation positive regulation of epidermal cell differentiation negative regulation of myoblast differentiation positive regulation of neuron differentiation positive regulation of osteoblast differentiation positive regulation of ossification negative regulation of cell cycle negative regulation of mitotic nuclear division negative regulation of striated muscle tissue development negative regulation of transcription, DNA-templated positive regulation of transcription, DNA-templated positive regulation of transcription from RNA polymerase II promoter lung alveolus development mesodermal cell differentiation intermediate mesodermal cell differentiation camera-type eye morphogenesis embryonic morphogenesis anatomical structure formation involved in morphogenesis regulation of smooth muscle cell proliferation positive regulation of smooth muscle cell proliferation negative regulation of smooth muscle cell proliferation neuron fate commitment embryonic cranial skeleton morphogenesis embryonic skeletal system morphogenesis embryonic skeletal system development smooth muscle tissue development stem cell differentiation epithelial cell proliferation positive regulation of epithelial cell proliferation negative regulation of epithelial cell proliferation positive chemotaxis smooth muscle cell differentiation regulation of smooth muscle cell differentiation cartilage development negative regulation of multicellular organismal process cardiac muscle cell differentiation positive regulation of cardiac muscle fiber development lens induction in camera-type eye embryonic skeletal joint morphogenesis bone development cranial suture morphogenesis positive regulation of SMAD protein import into nucleus lung morphogenesis lung vasculature development epithelium development bronchus development trachea development trachea formation epithelial tube branching involved in lung morphogenesis branching involved in prostate gland morphogenesis bud elongation involved in lung branching epithelial cell proliferation involved in lung morphogenesis bud dilation involved in lung branching prostate gland morphogenesis prostatic bud formation muscle tissue development mammary gland formation epithelial-mesenchymal cell signaling negative regulation of prostatic bud formation regulation of branching involved in prostate gland morphogenesis regulation of morphogenesis of a branching structure coronary vasculature development regulation of cartilage development positive regulation of cartilage development positive regulation of branching involved in lung morphogenesis pharyngeal arch artery morphogenesis negative regulation of thymocyte apoptotic process positive regulation of ERK1 and ERK2 cascade cellular response to growth factor stimulus cellular response to BMP stimulus glomerular capillary formation negative regulation of glomerular mesangial cell proliferation nephric duct formation ureter morphogenesis negative regulation of mesenchymal cell proliferation involved in ureter development regulation of branching involved in ureteric bud morphogenesis negative regulation of branching involved in ureteric bud morphogenesis negative regulation of glomerulus development positive regulation of protein localization to nucleus positive regulation of p38MAPK cascade positive regulation of odontoblast differentiation regulation of miRNA transcription negative regulation of pri-miRNA transcription from RNA polymerase II promoter pericyte cell differentiation negative regulation of vascular smooth muscle cell proliferation negative regulation of vascular associated smooth muscle cell migration cardiac jelly development positive regulation of cardiac neural crest cell migration involved in outflow tract morphogenesis regulation of mesodermal cell differentiation negative regulation of metanephric S-shaped body morphogenesis negative regulation of metanephric comma-shaped body morphogenesis positive regulation of primary miRNA processing regulation of cardiac muscle cell differentiation negative regulation of extrinsic apoptotic signaling pathway activation of MAPKK activity ovarian follicle development eye development regulation of endothelial cell proliferation BMP signaling pathway involved in heart induction mesenchymal to epithelial transition involved in metanephros morphogenesis common-partner SMAD protein phosphorylation multicellular organism development tissue development positive regulation of calcium ion transport into cytosol positive regulation of endothelial cell migration positive regulation of pathway-restricted SMAD protein phosphorylation positive regulation of cell death positive regulation of neuron projection development positive regulation of vascular endothelial growth factor receptor signaling pathway protein localization to nucleus cellular response to oxidative stress growth negative regulation of phosphorylation negative regulation of apoptotic process steroid hormone mediated signaling pathway negative regulation of MAP kinase activity positive regulation of cell differentiation negative regulation of oligodendrocyte differentiation branching morphogenesis of an epithelial tube inner ear receptor cell differentiation regulation of pathway-restricted SMAD protein phosphorylation SMAD protein signal transduction negative regulation of cell death BMP signaling pathway involved in ureter morphogenesis BMP signaling pathway involved in renal system segmentation pulmonary artery endothelial tube morphogenesis positive regulation of hepatocyte differentiation regulation of ERK1 and ERK2 cascade cellular response to dexamethasone stimulus BMP signaling pathway involved in nephric duct formation renal system development negative regulation of branch elongation involved in ureteric bud branching by BMP signaling pathway specification of ureteric bud anterior/posterior symmetry by BMP signaling pathway mesenchymal cell differentiation involved in kidney development ureter epithelial cell differentiation ureter smooth muscle cell differentiation metanephric collecting duct development positive regulation of kidney development positive regulation of branching involved in ureteric bud morphogenesis positive regulation of store-operated calcium channel activity positive regulation of mesenchymal stem cell proliferation positive regulation of DNA-dependent DNA replication negative regulation of cell proliferation involved in heart morphogenesis positive regulation of endothelial cell apoptotic process mesenchymal cell differentiation involved in renal system development
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Hong Kong flag icon
          Hong Kong

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-9fm2r:80/100.66.79.29:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline