Applications | Tested Dilution | Publications |
---|---|---|
Western Blot (WB) |
0.1-0.5 µg/mL | - |
ELISA (ELISA) |
0.1-0.5 µg/mL | - |
Product Specifications | |
---|---|
Species Reactivity |
Human, Mouse |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-4. |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Antigen affinity chromatography |
Storage buffer |
PBS with 5mg BSA |
Contains |
0.05mg sodium azide |
Storage conditions |
-20°C |
RRID |
AB_2745992 |
The synthetic peptide sequence is 293-324aa, SPKHHSQRARKKNKNCRRHSLYVDFSDVGWND
Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.
The protein encoded by this gene is a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. This particular family member plays an important role in the onset of endochondral bone formation in humans, and a reduction in expression has been associated with a variety of bone diseases, including the heritable disorder Fibrodysplasia Ossificans Progressiva. Alternative splicing in the 5' untranslated region of this gene has been described and three variants are described, all encoding an identical protein.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: BMP; BMP-2B; BMP-4; Bone morphogenetic protein; Bone morphogenetic protein 2B; Bone morphogenetic protein 4; bone morphogenetic protein 4 preproprotein
Gene Aliases: Bmp-4; BMP2B; Bmp2b-1; BMP2B1; BMP4; Dvr-4; DVR4; MCOPS6; OFC11; ZYME
UniProt ID: (Human) P12644, (Mouse) P21275
Entrez Gene ID: (Human) 652, (Mouse) 12159
Molecular Function:
growth factor
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support