Search
Invitrogen
BMP5 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
PA5-78878
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Published species
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Amount
100 µg
Purification
Antigen affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: Rat Liver Tissue, Mouse Liver Tissue, A549 whole cell. IHC: mouse liver tissue, rat lung tissue, human lung cancer tissue. Flow: U20S cell.
Target Information
TGF-β family members are key modulators of cell proliferation, differentiation, matrix synthesis, and apoptosis. As implied by their name, BMPs initiate, promote, and regulate the development, growth, and remodeling of bone and cartilage. In addition to this role, BMPs are also involved in prenatal development and postnatal growth, remodeling, and maintenance of a variety of other tissues and organs. BMP-5 is expressed in the nervous system, lungs and liver. It is a known regulator for dendritic growth in sympathetic neurons. BMP-5 is a 454 amino acid precursor protein that is cleaved to release the biologically active C-terminal mature protein.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Bioinformatics
Protein Aliases: BMP; BMP 5; BMP-5; Bone morphogenetic protein; Bone morphogenetic protein 5; MGC34244; ostegenic protein-5; short ear; tgf-beta; unnamed protein product
Gene Aliases: AU023399; Bmp-5; BMP5; se
UniProt ID: (Human) P22003, (Mouse) P49003
Entrez Gene ID: (Human) 653, (Mouse) 12160, (Rat) 315824
skeletal system development
ossification
endocardial cushion formation
type B pancreatic cell development
pericardium morphogenesis
pattern specification process
heart development
positive regulation of cell proliferation
negative regulation of cell proliferation
tissue development
negative regulation of epithelial to mesenchymal transition
negative regulation of steroid biosynthetic process
neural fold elevation formation
cell differentiation
BMP signaling pathway
male genitalia development
hindbrain development
negative regulation of aldosterone biosynthetic process
regulation of cell proliferation
negative regulation of insulin-like growth factor receptor signaling pathway
ear development
positive regulation of transcription from RNA polymerase II promoter
cell development
cardiac muscle tissue development
positive regulation of epithelial cell proliferation
positive regulation of developmental process
cartilage development
pharyngeal system development
positive regulation of SMAD protein import into nucleus
cardiac septum morphogenesis
chorio-allantoic fusion
heart trabecula morphogenesis
negative regulation of mononuclear cell migration
anterior head development
positive regulation of dendrite development
negative regulation of extrinsic apoptotic signaling pathway via death domain receptors
allantois development
negative regulation of cortisol biosynthetic process
multicellular organism development
positive regulation of pathway-restricted SMAD protein phosphorylation
growth
regulation of apoptotic process
regulation of MAPK cascade
SMAD protein signal transduction
positive regulation of DNA-dependent DNA replication
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support