Hamburger Menu Button
Thermo Fisher Scientific Logo
登入
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Tubes
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Clinical Genomics
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO 和 CRO 服務
    • CDMO 服務
    • 臨床試驗 CRO 服務
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • Register for an Account
    • How to Order
    • Instrument Support
    • Technical Support Centers
    • Learning Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • 快速訂購
          • 登入
            登入
            Don't have an account ? Create Account
            • 帳戶
            • 訂單
            • 訂製產品與專案

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • BMP5 Antibodies

          Invitrogen

          BMP5 Polyclonal Antibody

          1 Published Figure
          1 Reference
          View all (27) BMP5 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Protocols
          Questions & Answers
          Tech Support

          Cite BMP5 Polyclonal Antibody

          • Antibody Testing Data (5)
          • Published Figures (1)
          BMP5 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          BMP5 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 6

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          BMP5 Antibody (PA5-78878) in IHC (P)

          Immunohistochemistry analysis of BMP5 on paraffin-embedded human lung cancer tissue. Sample was incubated with BMP5 polyclonal antibody (Product# PA5-78878). {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          BMP5 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          BMP5 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          BMP5 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          BMP5 Antibody in Western Blot (WB)
          BMP5 Antibody in Flow Cytometry (Flow)
          BMP5 Antibody in Immunohistochemistry (IHC)
          BMP5 Polyclonal Antibody

          Product Details

          PA5-78878

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (IHC)

          -
          View 1 publication 1 publication

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -

          ELISA (ELISA)

          0.1-0.5 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Published species

          Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL).
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2745994

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: Rat Liver Tissue, Mouse Liver Tissue, A549 whole cell. IHC: mouse liver tissue, rat lung tissue, human lung cancer tissue. Flow: U20S cell.

          Target Information

          TGF-β family members are key modulators of cell proliferation, differentiation, matrix synthesis, and apoptosis. As implied by their name, BMPs initiate, promote, and regulate the development, growth, and remodeling of bone and cartilage. In addition to this role, BMPs are also involved in prenatal development and postnatal growth, remodeling, and maintenance of a variety of other tissues and organs. BMP-5 is expressed in the nervous system, lungs and liver. It is a known regulator for dendritic growth in sympathetic neurons. BMP-5 is a 454 amino acid precursor protein that is cleaved to release the biologically active C-terminal mature protein.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          Bioinformatics

          Protein Aliases: BMP; BMP 5; BMP-5; bone morphogenenic protein-5; Bone morphogenetic protein; Bone morphogenetic protein 5; MGC34244; short ear

          View more View less

          Gene Aliases: AU023399; Bmp-5; BMP5; se

          View more View less

          UniProt ID: (Human) P22003, (Mouse) P49003

          View more View less

          Entrez Gene ID: (Human) 653, (Mouse) 12160, (Rat) 315824

          View more View less

          Function(s)
          cytokine activity transforming growth factor beta receptor binding growth factor activity BMP receptor binding protein binding growth factor
          Process(es)
          skeletal system development ossification type B pancreatic cell development pattern specification process negative regulation of cell proliferation negative regulation of epithelial to mesenchymal transition positive regulation of pathway-restricted SMAD protein phosphorylation negative regulation of steroid biosynthetic process BMP signaling pathway male genitalia development negative regulation of aldosterone biosynthetic process growth regulation of apoptotic process regulation of MAPK cascade negative regulation of insulin-like growth factor receptor signaling pathway positive regulation of transcription from RNA polymerase II promoter positive regulation of epithelial cell proliferation cartilage development SMAD protein signal transduction negative regulation of mononuclear cell migration positive regulation of dendrite development negative regulation of extrinsic apoptotic signaling pathway via death domain receptors negative regulation of cortisol biosynthetic process positive regulation of DNA-dependent DNA replication multicellular organism development cell differentiation cell development
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Hong Kong flag icon
          Hong Kong

          Your items have has been added!


          Host server : magellan-search-green-55658555d6-qfdf2:80/100.66.76.55:80.
          git-commit: ec8e7df5f8fec8d765bd419205f1b5046a016d37
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.41.0-Offline