Search Thermo Fisher Scientific
Search Thermo Fisher Scientific
Applications | Tested Dilution | Publications |
---|---|---|
Western Blot (WB) |
0.1-0.5 µg/mL | - |
Immunohistochemistry (Paraffin) (IHC (P)) |
0.5-1 µg/mL | - |
Product Specifications | |
---|---|
Species Reactivity |
Human, Mouse, Rat |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence of human MCUR1 (ATQQAEIIVSALVKILEANMDIVYKDMVTKMQQE). |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Affinity chromatography |
Storage buffer |
PBS with 4mg trehalose |
Contains |
0.05mg sodium azide |
Storage conditions |
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
RRID |
AB_2807430 |
Reconstitute with 0.2 ml of distilled water to yield a concentration of 500 µg/ml.
Mcur1 encodes a protein that is a key regulator of mitochondrial calcium uniporter (MCU) required for calcium entry into mitochondrion. Mcur1 plays a direct role in uniporter-mediated calcium uptake via a direct interaction with MCU (mitochondrial calcium uniporter). Mcur1 may be involved in the assembly of the membrane components of the uniporter complex.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: coiled-coil domain containing 90A; Coiled-coil domain-containing protein 90A, mitochondrial; MCU regulator 1; MCURI1; Mitochondrial calcium uniporter regulator 1
Gene Aliases: 6230416A05Rik; AU015498; AV136929; AW554392; C6orf79; C88263; CCDC90A; FMP32; MCUR1; RGD1307673
UniProt ID: (Human) Q96AQ8, (Mouse) Q9CXD6
Entrez Gene ID: (Human) 63933, (Mouse) 76137, (Rat) 291034
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support