Search
Search
Invitrogen
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
The synthetic peptide sequence is 260-290aa, FVSAFQDVLFTNQCEQSKQLDLAMQVTEVIA
Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.
Chemokines play important roles in inflammation and are critical for the recruitment of effector immune cells to sites of infection. Chemokines activate leukocytes by binding to G protein coupled receptors. The ever-growing chemokine receptor subtypes can be divided into 2 major groups, CXCR and CCR, based on the 2 major classes of chemokines. One of the CCR receptors, CCR1, is expressed on neutrophils, monocytes, lymphocytes, and eosinophils and binds the leukocyte chemoattractant and hemopoiesis regulator macrophage-inflammatory protein (MIP-1 ), eotaxin, as well as several other related chemokines. Mice lacking the chemokine receptor CCR1 have defects in neutrophil trafficking and proliferation.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support