The synthetic peptide sequence is 731-761aa, QAMWYTDEDHGIASSTAHQHIYTHMSHFIKQ
Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.
CD26 (dipeptidyl peptidase IV, DPP IV), adenosine deaminase (ADA) binding protein) is a homodimeric atypical serine protease belonging to the prolyl oligopeptidase family. CD26 is expressed on lymphocyte cells and is upregulated during T-cell activation. CD26 is also expressed on activated B cells and natural killer cells and abundantly on epithelia. CD26 is implicated in a variety of biological functions including T-cell activation, cell adhesion with extracellular matrix such as fibronectin or collagens, and in HIV infection. Cross-linking of CD26 using this antibody dramatically enhances the anti CD3-induced IL - 2 production. CD26 identical to adenosine deaminase complexing protein-2, and to the T-cell activation antigen CD26. Further, CD26 is an intrinsic membrane glycoprotein and a serine exopeptidase that cleaves X-proline dipeptides from the N-terminus of polypeptides. Alterations in CD26 peptidase activity are characteristic of malignant transformation, and the enzymatic activity increases dramatically with tumor grade and severity. CD26 is expressed in various blood cell types, but also in cells that are histogenetically related to activated fibroblasts. Alterations in CD26 density have been reported on circulating monocytes and CD4+ T cells during rheumatoid arthritis and systemic lupus erythematosus.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: ADABP; ADCP-2; Adenosine deaminase complexing protein 2; Bile canaliculus domain-specific membrane glycoprotein; CD26; Dipeptidyl peptidase 4; Dipeptidyl peptidase 4 60 kDa soluble form; Dipeptidyl peptidase 4 membrane form; Dipeptidyl peptidase 4 soluble form; Dipeptidyl peptidase IV; Dipeptidyl peptidase IV 60 kDa soluble form; Dipeptidyl peptidase IV membrane form; Dipeptidyl peptidase IV soluble form; dipeptidyl-peptidase 4; dipeptidylpeptidase 4; dipeptidylpeptidase IV (CD26, adenosine deaminase complexing protein 2); DPP IV; DPP-IV; GP110 glycoprotein; T-cell activation antigen CD26; TP103
Gene Aliases: ADABP; ADCP2; CD26; DPP4; DPPIV; TP103
UniProt ID: (Human) P27487, (Rat) P14740
Entrez Gene ID: (Human) 1803, (Rat) 25253
Molecular Function:
enzyme modulator
hydrolase
protease
serine protease
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support