Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
CD41 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
PA5-79527
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Published species
C. elegans,
Mouse
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human ITGA2B (677-711aa EAELAVHLPQGAHYMRALSNVEGFERLICNQKKEN).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human HEL whole cell, human HEL whole cell, human K562 whole cell. IHC: mouse lung tissue, rat lung tissue, human mammary cancer tissue.
Target Information
CD41, also known as platelet glycoprotein IIb or ITGA2B, is a protein composed of two subunits: a 120 kDa alpha subunit and a 23 kDa beta subunit. It interacts with CD61 (gpIIIa, integrin beta III) in the presence of calcium to form a functional adhesive protein receptor. Initially thought to be expressed exclusively on platelets and megakaryocytes, CD41 is also found on hematopoietic progenitors in the embryo, fetus, and adult, indicating its role in early stages of hematopoietic differentiation. CD41 plays a crucial role in platelet function and blood coagulation by mediating platelet aggregation. Upon blood vessel damage, CD41 binds to various adhesion molecules, including von Willebrand factor, fibrinogen, fibronectin, and vitronectin, facilitating platelet adhesion and aggregation. This receptor is essential for platelet function, contributing to the binding of several adhesion molecules and playing a significant role in hemostasis. Diseases associated with CD41 dysfunction include Glanzmann Thrombasthenia and Platelet type-16 bleeding disorder, highlighting its importance in normal platelet function and blood coagulation processes.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Bioinformatics
Protein Aliases: alpha IIb; alphaIIb protein; CD41; form 1; form 2; GP IIb; GPalpha IIb; GPIIb; integrin alpha 2b (Cd41b); Integrin alpha-IIb; integrin, alpha 2B; integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41); platelet fibrinogen receptor, alpha subunit; platelet glycoprotein IIb of IIb/II Ia complex; platelet glycoprotein IIb of IIb/IIIa complex; Platelet membrane glycoprotein IIb; platelet-specific antigen BAK; protein phosphatase 1, regulatory subunit 93
Gene Aliases: AI172977; alphaIIb; BDPLT16; BDPLT2; CD41; CD41B; GP2B; GPIIb; GT; GTA; HPA3; ITGA2B; ITGAB; PPP1R93
UniProt ID: (Human) P08514, (Mouse) Q9QUM0
Entrez Gene ID: (Human) 3674, (Rat) 685269, (Mouse) 16399
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support