Applications | Tested Dilution | Publications |
---|---|---|
Western Blot (WB) |
0.1-0.5 µg/mL | - |
Product Specifications | |
---|---|
Species Reactivity |
Mouse |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence at the N-terminus of mouse CD46, different from the related human sequence by twelve amino acids, and from the related rat sequence by nine amino acids. |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Affinity chromatography |
Storage buffer |
PBS with 5mg BSA |
Contains |
0.05mg sodium azide |
Storage conditions |
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
RRID |
AB_2807138 |
Synthetic peptide sequence: 46-76aa, ELPRPFEAMELKGTPKLFYAVGEKIEYKCKK.
Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
CD46 (MCP, membrane cofactor protein) is a multifunctional cell surface transmembrane protein that binds and inactivates C3b and C4b complement fragments, regulates T cell-induced inflammatory responses by either inhibiting (CD46-1 isoform) or increasing (CD46-2 isoform) the contact hypersensitivity reaction. CD46 also serves as a receptor for several human pathogens (both bacteria and viruses), and its ligation alteres T lymphocyte polarization toward antigen-presenting cells or target cells, inhibiting lymphocyte function. CD46 is a protector of placental tissue and is also expressed on the inner acrosomal membrane of spermatozoa.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: CD46; Membrane cofactor protein; MGC26544
Gene Aliases: Cd46; Mcp
UniProt ID: (Mouse) O88174
Entrez Gene ID: (Mouse) 17221
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support