Synthetic peptide sequence: 142-178aa, QYQVVLVEPKTAWRLDCAQLKEKNQWQLSADDLKKLK.
Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
CNP may participate in RNA metabolism in the myelinating cell, CNP is the third most abundant protein in central nervous system myelin.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: 2', 3' cyclic nucleotide 3' phosphohydrolase; 2',3'-cyclic-nucleotide 3'-phosphodiesterase; CNP; CNPase; cyclic nucleotide phosphodiesterase 1
Gene Aliases: CNP; Cnp-1; CNP1; CNPase; CNPF; CNPI; CNPII
UniProt ID: (Human) P09543, (Mouse) P16330, (Rat) P13233
Entrez Gene ID: (Human) 1267, (Mouse) 12799, (Rat) 25275
Molecular Function:
hydrolase
phosphodiesterase
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support