Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
CRY2 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
PA5-79073
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human CRY2 (171-200aa RFQAIISRMELPKKPVGLVTSQQMESCRAE).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: Rat Testis Tissue, Rat Brain Tissue, Mouse Brain Tissue, 22RV1 whole cell. IHC: rat liver tissue, mouse kidney tissue.
Target Information
Various biochemical, physiological and behavioral processes display circadian rhythms controlled by an internal biological clock. The central "gears" driving this clock appear to be composed of an autoregulatory transcription/post translation-based feedback loop. Cryptochrome 1 (CRY1) and 2 (CRY2) are DNA-binding flavoproteins that bear some homology to blue-light receptors and photolyases. In Drosophila, CRY is a photoreceptor for the circadian clock where it binds to the clock component TIM in a light-dependent fashion and blocks its function. Mammalian CRY1 and CRY2 function via light-independent interactions with circadian genes CLOCK and BMAL1, as well as with PER1, PER2, and TIM. They seem to act as light-independent components of the circadian clock and likely regulate Per1 transcriptional cycling via interactions with both the activator and its feedback inhibitors. Mutant mice not expressing the Cry1 or Cry2 protein display accelerated and delayed periodicity of locomotor activity, respectively. It appears that the combination of both proteins working together is essential to synchronize the organism to circadian phases. A critical balance between Cry1 and Cry2 is required for proper clock function; in complete darkness, double-mutant mice present with instantaneous arrhythmicity, indicating the absence of an internal circadian clock.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: cryptochrome 2 (photolyase-like); Cryptochrome-2; growth-inhibiting protein 37
Gene Aliases: AV006279; CRY2; D130054K12Rik; HCRY2; KIAA0658; PHLL2
UniProt ID: (Human) Q49AN0, (Mouse) Q9R194
Entrez Gene ID: (Human) 1408, (Rat) 170917, (Mouse) 12953
transcription regulatory region sequence-specific DNA binding
transcription factor activity, transcription factor binding
DNA binding
damaged DNA binding
single-stranded DNA binding
deoxyribodipyrimidine photo-lyase activity
DNA (6-4) photolyase activity
protein binding
blue light photoreceptor activity
phosphatase binding
ubiquitin binding
FAD binding
DNA photolyase activity
photoreceptor activity
kinase binding
protein kinase binding
nuclear hormone receptor binding
nucleotide binding
DNA photolyase
negative regulation of transcription from RNA polymerase II promoter
photoreactive repair
transcription, DNA-templated
circadian rhythm
blue light signaling pathway
protein-chromophore linkage
negative regulation of phosphoprotein phosphatase activity
circadian regulation of gene expression
glucose homeostasis
regulation of circadian rhythm
negative regulation of circadian rhythm
entrainment of circadian clock by photoperiod
negative regulation of transcription, DNA-templated
regulation of sodium-dependent phosphate transport
negative regulation of glucocorticoid receptor signaling pathway
DNA repair
protein import into nucleus
signal transduction
lipid storage
response to insulin
negative regulation of glucocorticoid secretion
regulation of transcription, DNA-templated
rhythmic process
response to stimulus
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support