Search
Invitrogen
CTR1 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
FIGURE: 1 / 1
CTR1 Antibody (PA5-80029) in WB
Western blot analysis of CTR1 in Lane 1: human HepG2 whole cell lysate, Lane 2: human PANC-1 whole cell lysate using 50 µg (reducing conditions) per well. Electrophoresis was performed on 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours and protein was transferred to a nitrocellulose membrane at 150mA for 50-90 minutes. Sample was blocked with 5% Non-fat Milk/TBS for 1.5 hours at room temperature, incubated with CTR1 polyclonal antibody (Product # PA5-80029) at a dilution of 0.5 µg/mL (overnight at 4°C), followe... View More
Product Details
PA5-80029
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence of human SLC31A1/CTR1 (NGTILMETHKTVGQQMLSFPHLLQTVLHIIQ).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Amount
100 µg
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human HepG2 whole cell, human PANC-1 whole cell.
Target Information
The trace metal copper (Cu) plays a crucial role in mammalian cells as a cofactor for many enzymes. Cu-related genetic diseases, such as Menkes disease and Wilson disease, arise from a lack of Cu homeostasis in mammalian cells. CTR1 is a high-affinity copper-uptake protein. The C-terminal domain is similar to the Raf family of protein kinases, but it's first two-thirds encodes a novel protein domain. CTR1 provides the primary avenue for copper uptake in mammalian cells, thereby, affecting Cu homeostasis and embryonic development.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: At5g03730; AtCTR1; CONSTITUTIVE TRIPLE RESPONSE 1; copper transport 1 homolog; Copper transporter 1; Copper uptake transporter 1; CTR1; F17C15.150; F17C15_150; hCTR1; High affinity copper uptake protein 1; Liver regeneration-related protein LRRGT00200; rCTR1; SIS1; solute carrier family 13 (sodium/sulphate symporters), member 1; solute carrier family 31 (copper transporter), member 1; solute carrier family 31 (copper transporters), member 1; Solute carrier family 31 member 1; SUGAR-INSENSITIVE 1; unnamed protein product
Gene Aliases: 4930445G01Rik; AI787263; AU016967; COPT1; CTR1; LRRGT00200; NSCT; SLC31A1
UniProt ID: (Human) O15431, (Rat) Q9JK41, (Mouse) Q8K211
Entrez Gene ID: (Human) 1317, (Rat) 171135, (Mouse) 20529
angiogenesis
ion transport
copper ion transport
cellular copper ion homeostasis
copper ion import
plasma membrane copper ion transport
copper ion transmembrane transport
vascular endothelial growth factor receptor-2 signaling pathway
xenobiotic transport
protein oligomerization
establishment of localization in cell
silver ion transmembrane transport
drug transmembrane transport
cellular response to cisplatin
copper ion import into cell
transport
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support