Applications | Tested Dilution | Publications |
---|---|---|
Western Blot (WB) |
0.1-0.5 µg/mL | - |
Product Specifications | |
---|---|
Species Reactivity |
Human, Mouse, Rat |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence of human SLC31A1/CTR1. |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Antigen affinity chromatography |
Storage buffer |
PBS with 4mg trehalose |
Contains |
0.05mg sodium azide |
Storage conditions |
-20°C |
RRID |
AB_2747144 |
The synthetic peptide sequence is NGTILMETHKTVGQQMLSFPHLLQTVLHIIQ
Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.
The trace metal copper (Cu) plays a crucial role in mammalian cells as a cofactor for many enzymes. Cu-related genetic diseases, such as Menkes disease and Wilson disease, arise from a lack of Cu homeostasis in mammalian cells. CTR1 is a high-affinity copper-uptake protein. The C-terminal domain is similar to the Raf family of protein kinases, but it's first two-thirds encodes a novel protein domain. CTR1 provides the primary avenue for copper uptake in mammalian cells, thereby, affecting Cu homeostasis and embryonic development.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: copper transport 1 homolog; Copper transporter 1; Copper uptake transporter 1; CTR1; hCTR1; High affinity copper uptake protein 1; Liver regeneration-related protein LRRGT00200; rCTR1; solute carrier family 13 (sodium/sulphate symporters), member 1; solute carrier family 31 (copper transporter), member 1; solute carrier family 31 (copper transporters), member 1; Solute carrier family 31 member 1
Gene Aliases: 4930445G01Rik; AI787263; AU016967; COPT1; CTR1; LRRGT00200; SLC31A1
UniProt ID: (Human) O15431, (Rat) Q9JK41, (Mouse) Q8K211
Entrez Gene ID: (Human) 1317, (Rat) 171135, (Mouse) 20529
Molecular Function:
secondary carrier transporter
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support