Applications | Tested Dilution | Publications |
---|---|---|
Western Blot (WB) |
1:1,000 | View 1 publication 1 publication |
Immunohistochemistry (IHC) |
1:100-1:500 | - |
Immunoprecipitation (IP) |
1:300-1:500 | - |
Product Specifications | |
---|---|
Species Reactivity |
Mouse, Rat |
Published species |
Mouse |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
Recombinant protein was generated using E coli-expressed mouse SDF-1alpha as an immunogen. The sequence of mouse SDF-1 alpha antigen is DGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK. |
Conjugate |
Unconjugated |
Form |
Liquid |
Concentration |
1 mg/mL |
Purification |
Protein A |
Storage buffer |
PBS, pH 7.2 |
Contains |
0.1% sodium azide |
Storage conditions |
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
RRID |
AB_2276940 |
PA1-29029 detects CXCL12 from rat and mouse samples.
CXCL12 is a stromal cell-derived alpha chemokine member of the intercrine family. This gene product and its receptor CXCR4 can activate lymphocytes and have been implicated in the metastasis of some cancers such as breast cancer. Mutations in this gene are associated with resistance to human immunodeficiency virus type 1 infections. Multiple transcript variants encoding different isoforms have been found for this gene.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: 12-O-tetradecanoylphorbol 13-acetate repressed protein 1; AI174028; C Cmotif chemokine; C X C motif chemokine; C-X-C motif chemokine 12; CC motif chemokine; CCmotif chemokine; chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1); CXC; CXC motif chemokine; CXCL; hIRH; hSDF-1; PBSF; Pre-B cell growth-stimulating factor; pre-B-cell growth-stimulating factor; SDF-1; SDF-1 gamma; SDF-1a; SDF-1b; Stromal cell-derived factor 1; stromal cell-derived factor-1 alpha; stromal cell-derived factor-1 gamma; Thymic lymphoma cell-stimulating factor; TLSF; TLSF-a; TLSF-b; Tlsfa; Tlsfb; TPAR1
Gene Aliases: Cxcl12; Pbsf; Scyb12; Sdf1; Tlsf; Tpar1
UniProt ID: (Mouse) P40224
Entrez Gene ID: (Rat) 24772, (Mouse) 20315
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support