Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Promotions
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • Quick Order
          • Promos
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central
          • Primary Antibodies ›
          • CYP2D6 Antibodies

          Invitrogen

          CYP2D6 Polyclonal Antibody

          1 Reference
          View all (23) CYP2D6 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Datasheet
          Certificates
          Protocols
          Questions & Answers

          Cite CYP2D6 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (5)
          CYP2D6 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          CYP2D6 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 5

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          CYP2D6 Antibody (PA5-79129) in IHC (P)

          Immunohistochemistry analysis of CYP2D6 on paraffin-embedded human liver cancer tissue. Antigen retrieval was performed using citrate buffer (pH6, epitope retrieval solution) for 20 mins. Sample was blocked using 10% goat serum, incubated with CYP2D6 polyclonal antibody (Product# PA5-79129) with a dilution of 1 µg/mL (overnight at 4°C), and followed by biotinylated goat anti-rabbit IgG (30 minutes at 37°C).... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          CYP2D6 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          CYP2D6 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          CYP2D6 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          CYP2D6 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          CYP2D6 Antibody in Western Blot (WB)
          CYP2D6 Polyclonal Antibody

          Product Details

          PA5-79129

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (IHC)

          -
          View 1 publication 1 publication

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Published species

          Mouse

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human Cytochrome P450 2D6 (315-347aa AWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEM).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2746245

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: rat liver tissue, mouse liver tissue. IHC: rat intestine tissue, mouse liver tissue, human liver cancer tissue, mouse intestine tissue.

          Target Information

          Cytochrome p450 2D6 (CYP2D6) is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant. The gene is highly polymorphic in the population; certain alleles result in the poor metabolizer phenotype, characterized by a decreased ability to metabolize the enzyme's substrates. The gene is located near two cytochrome P450 pseudogenes on chromosome 22q13.1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          Bioinformatics

          Protein Aliases: Cholesterol 25-hydroxylase; CYP2D6; CYPIID18; CYPIID3; CYPIID4; CYPIID6; Cytochrome P450 2D-29; Cytochrome P450 2D-35; Cytochrome P450 2D18; Cytochrome P450 2D3; Cytochrome P450 2D4; Cytochrome P450 2D6; cytochrome P450, family 2, subfamily d, polypeptide 13; cytochrome P450, family 2, subfamily d, polypeptide 22; cytochrome P450, family 2, subfamily d, polypeptide 4; cytochrome P450, family 2, subfamily D, polypeptide 6; cytochrome P450, family 2, subfamily D, polypeptide 7 pseudogene 2; cytochrome P450, family 2, subfamily D, polypeptide 8 pseudogene 2; cytochrome P450, subfamily 2D, polypeptide 6; cytochrome P450, subfamily II (debrisoquine, sparteine, etc., -metabolising), polypeptide 7 pseudogene 2; cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolising), polypeptide 8 pseudogene 2; cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolizing), polypeptide 6; cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolizing)-like 1; cytochrome P450, subfamily IID, polypeptide 6; Cytochrome P450, subfamily IID3; Cytochrome P450, subfamily IID4; Cytochrome P450-CMF3; Cytochrome P450-DB1; Cytochrome P450-DB3; Cytochrome P450-DB4; Debrisoquine 4-hydroxylase; flavoprotein-linked monooxygenase; microsomal monooxygenase; nonfunctional cytochrome P450 2D6; P450 2D-29/2D-35; P450-CMF3; P450-DB3; P450-DB4; xenobiotic monooxygenase

          View more View less

          Gene Aliases: CPD6; CYP2D; Cyp2d-18; Cyp2d-3; Cyp2d-4; Cyp2d13; Cyp2d18; Cyp2d22; Cyp2d3; Cyp2d4; Cyp2d4v1; Cyp2d4v2; CYP2D6; CYP2D7AP; CYP2D7BP; CYP2D7P2; CYP2D8P2; CYP2DL1; CYPIID6; P450-DB1; P450C2D; P450DB1

          View more View less

          UniProt ID: (Human) P10635, (Rat) P12938, (Rat) Q64680

          View more View less

          Entrez Gene ID: (Human) 1565, (Rat) 24303, (Rat) 171522

          View more View less

          Function(s)
          monooxygenase activity iron ion binding oxidoreductase activity oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen heme binding metal ion binding anandamide 8,9 epoxidase activity anandamide 11,12 epoxidase activity anandamide 14,15 epoxidase activity arachidonic acid epoxygenase activity steroid hydroxylase activity oxygen binding aromatase activity steroid 21-monooxygenase activity drug binding arachidonic acid monooxygenase activity oxidoreductase oxygenase metabolite interconversion enzyme
          Process(es)
          lipid metabolic process fatty acid metabolic process xenobiotic metabolic process steroid metabolic process cholesterol metabolic process estrogen metabolic process coumarin metabolic process alkaloid metabolic process alkaloid catabolic process monoterpenoid metabolic process arachidonic acid metabolic process isoquinoline alkaloid metabolic process xenobiotic catabolic process retinol metabolic process long-chain fatty acid biosynthetic process oxidative demethylation negative regulation of cellular organofluorine metabolic process liver development exogenous drug catabolic process oxidation-reduction process female pregnancy response to organic substance drug metabolic process dopamine biosynthetic process dopamine metabolic process drug catabolic process heterocycle metabolic process negative regulation of binding
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy Consumer Health Data Privacy Policy
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Notice
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-blue-744bc48644-fvx7n:80/100.66.78.247:80.
          git-commit: 747bde55a712f6f97bf7760408d445eefba4e16f
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.48.0-Offline