The synthetic peptide sequence is 315-347aa, AWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEM
Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.
Cytochrome p450 2D6 (CYP2D6) is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant. The gene is highly polymorphic in the population; certain alleles result in the poor metabolizer phenotype, characterized by a decreased ability to metabolize the enzyme's substrates. The gene is located near two cytochrome P450 pseudogenes on chromosome 22q13.1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: Cholesterol 25-hydroxylase; CYPIID18; CYPIID3; CYPIID4; CYPIID6; Cytochrome P450 2D-29; Cytochrome P450 2D-35; Cytochrome P450 2D18; Cytochrome P450 2D3; Cytochrome P450 2D4; Cytochrome P450 2D6; cytochrome P450, family 2, subfamily d, polypeptide 13; cytochrome P450, family 2, subfamily d, polypeptide 22; cytochrome P450, family 2, subfamily d, polypeptide 4; cytochrome P450, family 2, subfamily D, polypeptide 6; cytochrome P450, family 2, subfamily D, polypeptide 7 pseudogene 2; cytochrome P450, family 2, subfamily D, polypeptide 8 pseudogene 2; cytochrome P450, subfamily 2D, polypeptide 6; cytochrome P450, subfamily II (debrisoquine, sparteine, etc., -metabolising), polypeptide 7 pseudogene 2; cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolising), polypeptide 8 pseudogene 2; cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolizing), polypeptide 6; cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolizing)-like 1; cytochrome P450, subfamily IID, polypeptide 6; Cytochrome P450, subfamily IID3; Cytochrome P450, subfamily IID4; Cytochrome P450-CMF3; Cytochrome P450-DB1; Cytochrome P450-DB3; Cytochrome P450-DB4; Debrisoquine 4-hydroxylase; flavoprotein-linked monooxygenase; microsomal monooxygenase; nonfunctional cytochrome P450 2D6; P450 2D-29/2D-35; P450-CMF3; P450-DB3; P450-DB4; xenobiotic monooxygenase
Gene Aliases: CPD6; CYP2D; Cyp2d-18; Cyp2d-3; Cyp2d-4; Cyp2d13; Cyp2d18; Cyp2d22; Cyp2d3; Cyp2d4; Cyp2d4v1; Cyp2d4v2; CYP2D6; CYP2D7AP; CYP2D7BP; CYP2D7P2; CYP2D8P2; CYP2DL1; CYPIID6; P450-DB1; P450C2D; P450DB1
UniProt ID: (Human) P10635, (Rat) P12938, (Rat) Q64680
Entrez Gene ID: (Human) 1565, (Rat) 24303, (Rat) 171522
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support